Recombinant Phalaenopsis aphrodite subsp. formosana ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Target Names
atpI
Target Protein Sequence
MNVIPCSIKTLKGLYDISGVEVGQHLYWQIGGLQIHAQVLITSWVVIAILLGSVIIAVRN PQTIPTNGQNFFEYVLEFIQDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII KLPHGELAAPTNDINTTVALALPTSVAYFYAGLRKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpI) in orchid chloroplasts?

ATP synthase subunit a (atpI) is a transmembrane protein component of the F0 sector of the chloroplastic ATP synthase complex. In Phalaenopsis aphrodite subsp. formosana, this protein consists of 247 amino acids forming multiple transmembrane helices that span the thylakoid membrane . The primary amino acid sequence is characterized by hydrophobic regions necessary for membrane integration and charged residues that facilitate proton translocation.

Functionally, atpI forms part of the proton channel within the F0 sector, serving as a critical component in the proton-motive force conversion to mechanical energy used for ATP synthesis. The protein contains specific residues that interact with the c-ring of the ATP synthase, facilitating rotation driven by proton flow across the thylakoid membrane. This rotation ultimately drives conformational changes in the F1 sector where ATP synthesis occurs .

The atpI protein works in concert with other subunits including subunit b (atpF) and subunit alpha (atpA) to maintain the structural integrity of the ATP synthase complex while enabling efficient energy conversion in the chloroplast .

How does recombinant atpI differ from the native protein found in Phalaenopsis orchids?

Recombinant Phalaenopsis aphrodite subsp. formosana atpI is typically produced in expression systems such as E. coli (as indicated in the product information) rather than extracted directly from orchid tissue . Several key differences exist between the recombinant and native forms:

  • Tags and fusion partners: The recombinant protein often contains an N-terminal 10xHis-tag as indicated in the product specifications, which facilitates purification but is not present in the native protein .

  • Post-translational modifications: Native atpI may undergo specific post-translational modifications in orchid chloroplasts that are absent in recombinant proteins produced in prokaryotic expression systems.

  • Protein folding environment: The membrane protein folding environment in E. coli differs from that in orchid chloroplasts, potentially affecting tertiary structure.

  • Association with other ATP synthase components: In its native state, atpI is associated with other ATP synthase subunits in a fully assembled complex, whereas the recombinant protein is typically purified in isolation.

Despite these differences, properly folded recombinant atpI retains essential structural characteristics that make it valuable for antibody production, structural studies, and in vitro functional assays .

What are the storage requirements for maintaining the stability of recombinant atpI?

Maintaining stability of recombinant Phalaenopsis aphrodite subsp. formosana atpI requires careful attention to storage conditions. According to product documentation, the following guidelines are recommended:

  • Temperature: Store at -20°C for routine storage, or at -80°C for extended storage periods .

  • Freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein stability and functionality. It is recommended to prepare small working aliquots that can be stored at 4°C for up to one week of active use .

  • Buffer composition: The recombinant protein is typically supplied in a buffer containing stabilizing agents. For transmembrane proteins like atpI, buffer components often include glycerol (typically at concentrations of 20-50%) to prevent aggregation during freeze-thaw cycles .

  • Shelf life considerations: The stability of liquid form preparations is approximately 6 months at -20°C/-80°C, while lyophilized preparations can remain stable for approximately 12 months at the same temperature ranges .

For working with the protein, it is advisable to thaw aliquots on ice and handle them at 4°C whenever possible to minimize degradation during experimental procedures.

How can researchers effectively solubilize and reconstitute recombinant atpI for functional studies?

Solubilizing and reconstituting transmembrane proteins like atpI presents significant challenges due to their hydrophobic nature. A methodological approach includes:

  • Initial solubilization: For recombinant atpI, solubilization typically begins with selection of appropriate detergents. Mild non-ionic detergents such as n-dodecyl β-D-maltoside (DDM) at 1-2% or digitonin at 0.5-1% are often effective initial solubilizers for maintaining native-like protein conformation .

  • Detergent screening: A systematic approach involves testing multiple detergent types at various concentrations, assessing solubilization efficiency through techniques such as SDS-PAGE and Western blotting. The buffer conditions (pH, ionic strength) should be optimized alongside detergent selection.

  • Reconstitution into liposomes: For functional studies, atpI can be reconstituted into artificial liposomes composed of lipids that mimic the thylakoid membrane environment. This typically involves:

    • Preparation of liposomes using a mixture of phosphatidylcholine and phosphatidic acid (7:3 ratio)

    • Detergent-mediated incorporation of purified atpI

    • Detergent removal via dialysis or adsorption to Bio-Beads

  • Verification of insertion: Proper insertion orientation can be verified through protease protection assays or by using antibodies against specific epitopes expected to be exposed on particular faces of the membrane.

When reconstituting atpI with other ATP synthase subunits to form partial or complete complexes, sequential addition of components is recommended, starting with the most stable subunits as an assembly scaffold .

What approaches are most effective for studying interactions between atpI and other ATP synthase subunits?

Investigating the interactions between atpI and other ATP synthase subunits requires multiple complementary approaches:

The interaction between atpI and other subunits like atpF is particularly important for understanding how the membrane-embedded Fo sector stabilizes and functions in the complete ATP synthase complex .

How do sequence variations in atpI across different Phalaenopsis species affect ATP synthase function?

Sequence variations in atpI across different Phalaenopsis species can significantly impact ATP synthase function through several mechanisms:

  • Conservation analysis: Comparative sequence analysis of atpI across Phalaenopsis species reveals highly conserved residues in transmembrane domains and proton channel regions. These conserved amino acids typically include charged residues (Arg, Glu) essential for proton translocation and hydrophobic residues that maintain membrane helix stability .

  • Variable regions: Less conserved regions often correspond to species-specific adaptations that may influence:

    • Protein-protein interaction interfaces with other ATP synthase subunits

    • Regulatory binding sites

    • Thermal stability profiles related to environmental adaptation

  • Functional implications: Amino acid substitutions in key functional regions can alter:

    • Proton translocation efficiency

    • Complex assembly and stability

    • Regulatory responses to environmental stressors

Researchers can use site-directed mutagenesis to introduce specific sequence variations from different Phalaenopsis species into the recombinant atpI protein to assess their functional impact through in vitro reconstitution studies .

RegionP. aphrodite subsp. formosana atpI featureFunctional significanceConservation across Phalaenopsis species
N-terminal domainMNVIPCSIKT (residues 1-10)Interaction with other subunitsModerate conservation
Transmembrane helix 1LQIHAQVLITSWVVIAILLGSVIIAVRN (approx. residues 30-57)Core proton channel componentHigh conservation
Loop regionPQTIPTNGQNFFEYVLEFIQDLSKT (approx. residues 58-82)Regulatory regionLower conservation
Transmembrane helix 2Contains WPFIGTMFLFI motifMembrane anchoringHigh conservation
C-terminal domainContains YIGESMEGHHPotential interaction siteModerate conservation

What are the optimal expression systems and conditions for producing high-quality recombinant atpI?

Producing high-quality recombinant Phalaenopsis aphrodite subsp. formosana atpI requires careful selection of expression systems and optimization of conditions:

  • Expression system selection:

    • E. coli systems: Most commonly used as indicated in the product information, typically employing strains specialized for membrane protein expression such as C41(DE3), C43(DE3), or Lemo21(DE3) .

    • Baculovirus expression: Alternative system that can provide better folding for complex proteins, similar to that used for atpA as indicated in search result .

    • Cell-free expression systems: Emerging approach that bypasses toxicity issues often encountered with membrane protein overexpression.

  • Vector design considerations:

    • Promoter selection: For E. coli, the T7 promoter with tunable induction is preferred

    • Tags: N-terminal 10xHis-tag as mentioned in the product specification facilitates purification while minimizing interference with transmembrane domain insertion

    • Fusion partners: SUMO or MBP fusions can enhance solubility during expression

  • Expression condition optimization:

    • Temperature: Reduced temperature (16-20°C) during induction slows protein production and improves folding

    • Induction strength: Lower IPTG concentrations (0.1-0.5 mM) often yield better results for membrane proteins

    • Media supplements: Addition of glycerol (0.5-2%) and specific phospholipids can enhance membrane protein folding

  • Scale-up considerations:

    • Maintain optimal dissolved oxygen levels through appropriate agitation and aeration

    • Monitor pH throughout cultivation

    • Consider fed-batch approaches to achieve higher cell densities without overwhelming the cell's membrane protein insertion machinery

Optimal expression typically requires systematic testing of multiple conditions, with protein quality assessed through SDS-PAGE, Western blot, and functional assays specific to ATP synthase activity .

What purification strategies yield the highest purity and activity for recombinant atpI?

Purifying recombinant atpI to high homogeneity while maintaining functional activity requires a multi-step strategy:

  • Initial extraction and solubilization:

    • Cell lysis: Mechanical disruption (sonication or high-pressure homogenization) in buffer containing protease inhibitors

    • Membrane fraction isolation: Ultracentrifugation to separate membrane fractions (100,000-150,000 × g for 1 hour)

    • Detergent solubilization: Carefully optimized detergent concentration (typically 1-2% for initial extraction) in buffer containing 150-300 mM NaCl and glycerol (10-20%)

  • Affinity chromatography:

    • IMAC purification: Utilizing the N-terminal 10xHis-tag mentioned in the product specifications

    • Optimization of imidazole concentrations: Low imidazole (10-20 mM) in wash buffers and gradient or step elution (250-500 mM imidazole)

    • Detergent concentration: Reduced to 2-3× critical micelle concentration (CMC) during chromatography

  • Secondary purification:

    • Size exclusion chromatography: Separates monomeric protein from aggregates and removes contaminants

    • Ion exchange chromatography: Particularly useful for removing nucleic acid contaminants that often co-purify with membrane proteins

  • Quality assessment:

    • Purity analysis: SDS-PAGE with silver staining (>90% purity typical for structural/functional studies)

    • Activity assessment: Reconstitution into liposomes followed by proton translocation assays

    • Thermal stability: Differential scanning fluorimetry in the presence of appropriate detergents

Throughout purification, maintaining a consistent detergent environment is critical for stability. For highest activity retention, completing the purification process within 48-72 hours is recommended, with appropriate storage conditions implemented immediately after purification .

How can researchers develop reliable antibodies against atpI for immunological studies?

Developing reliable antibodies against Phalaenopsis aphrodite subsp. formosana atpI presents challenges due to its hydrophobic nature and multiple transmembrane domains. A systematic approach includes:

  • Antigen design strategies:

    • Recombinant full-length protein: Utilizing purified recombinant atpI with N-terminal 10xHis-tag as described in product specifications

    • Synthetic peptides: Targeting hydrophilic regions predicted to be exposed (typically N-terminal, C-terminal, or loop regions)

    • Fusion protein fragments: Expressing hydrophilic domains fused to carrier proteins like KLH or BSA

  • Immunization protocols:

    • Species selection: Rabbits typically provide good responses for polyclonal antibodies; mice or rats for monoclonal development

    • Adjuvant selection: Complete Freund's for initial immunization followed by incomplete Freund's for boosters

    • Immunization schedule: Initial immunization followed by 3-4 booster injections at 2-3 week intervals

  • Antibody purification and validation:

    • Affinity purification: Using immobilized antigen columns to isolate specific antibodies

    • Cross-adsorption: Against related proteins (e.g., homologous ATP synthase subunits) to remove cross-reactive antibodies

    • Validation methods:

      • Western blotting against recombinant protein and native extracts

      • Immunoprecipitation efficiency assessment

      • Immunolocalization in fixed orchid tissue sections

  • Characterization of antibody properties:

    • Epitope mapping: Determining the specific regions recognized using peptide arrays or hydrogen-deuterium exchange mass spectrometry

    • Affinity determination: Surface plasmon resonance (SPR) to determine binding kinetics

    • Cross-reactivity assessment: Testing against related ATP synthase subunits from different orchid species

For membrane proteins like atpI, antibodies directed against exposed loop regions often perform better in applications where the protein maintains its native conformation, while antibodies against internal regions may be more suitable for denatured applications like Western blotting .

How can researchers accurately quantify and compare expression levels of atpI across different orchid tissues or experimental conditions?

Accurately quantifying and comparing atpI expression levels requires a multi-faceted approach that accounts for the challenges of measuring membrane protein expression:

  • Transcript-level quantification:

    • RT-qPCR: Design of specific primers targeting atpI mRNA with careful validation of amplification efficiency

    • RNA-Seq analysis: For genome-wide expression comparisons across conditions

    • Normalization strategies: Use of multiple reference genes specifically validated for orchid tissues, such as those identified in flowering-related studies

  • Protein-level quantification:

    • Western blotting: Semi-quantitative approach using validated antibodies against atpI

    • Multiple reaction monitoring (MRM) mass spectrometry: Absolute quantification using isotopically labeled peptide standards corresponding to unique atpI sequences

    • Sample preparation considerations: Consistent membrane protein extraction efficiency across different tissue types

  • Data normalization approaches:

    • For transcript data: GAPDH, actin, or other stable reference genes validated in Phalaenopsis

    • For protein data: Total protein normalization or reference to other stable chloroplast membrane proteins

  • Statistical analysis:

    • Appropriate statistical tests for comparing expression levels (t-tests, ANOVA with post-hoc tests)

    • Accounting for biological variability across orchid specimens

    • Multi-factor analysis for experiments involving variables like temperature, light conditions, or developmental stages

When comparing expression levels, researchers should consider the relationship between transcript abundance and protein levels, which may not be directly proportional for membrane proteins due to post-transcriptional regulation and protein stability factors. The differential expression patterns observed in flowering-related genes in Phalaenopsis under warm day and cool night conditions provide a methodological template for similar studies with atpI .

What are the best approaches for characterizing the functional properties of purified recombinant atpI?

Characterizing the functional properties of purified recombinant atpI involves multiple complementary techniques that probe different aspects of the protein's activity and interactions:

  • Proton translocation assays:

    • Reconstitution into liposomes containing pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Measurement of fluorescence changes upon establishment of proton gradients

    • Inhibitor studies using specific ATP synthase inhibitors to confirm specificity

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content and stability

    • Limited proteolysis combined with mass spectrometry to identify flexible and structured regions

    • Single-particle cryo-EM if reconstituted with other ATP synthase components

  • Protein-protein interaction studies:

    • Surface plasmon resonance (SPR) with immobilized atpI to measure binding kinetics with other ATP synthase subunits

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of interactions

    • Microscale thermophoresis (MST) for quantifying interactions in solution with minimal protein consumption

  • Lipid interaction analysis:

    • Lipidomics to identify preferential lipid associations

    • Nanodiscs or lipid cubic phase crystallization to study the protein in membrane-like environments

    • Hydrogen-deuterium exchange mass spectrometry to identify membrane-embedded regions

  • Activity coupling assays:

    • When combined with other ATP synthase components, ATP synthesis/hydrolysis activity measurements

    • Proton gradient-driven conformational change detection using site-specific fluorescent labels

The functional data should be interpreted in the context of the known role of atpI in the complete ATP synthase complex, recognizing that some properties may only be observable when the protein is assembled with its partner subunits .

How can researchers interpret differences between in vitro studies using recombinant atpI and in vivo observations in orchid chloroplasts?

Interpreting differences between in vitro studies with recombinant atpI and in vivo observations requires careful consideration of multiple factors that influence protein behavior and function:

  • Physiological context differences:

    • Lipid environment: Native thylakoid membranes contain specific lipid compositions that may not be replicated in vitro

    • Protein complex assembly: In vivo, atpI functions as part of the complete ATP synthase complex with regulatory interactions

    • Post-translational modifications: Potential modifications present in vivo may be absent in recombinant systems

  • Methodological considerations:

    • Detergent effects: Detergents used for solubilization can alter protein conformation and activity

    • Concentration differences: Recombinant protein studies often use higher concentrations than physiological levels

    • Absence of regulatory factors: Small molecules or proteins that modulate activity in vivo

  • Bridging the gap strategies:

    • Native protein extraction: Comparing properties of native ATP synthase complexes extracted from orchid chloroplasts with reconstituted systems

    • Heterologous expression in plant systems: Using plant chloroplast transformation to express tagged versions in a more native-like context

    • In organello assays: Isolated intact chloroplasts can provide an intermediate system between in vitro and in vivo

  • Data integration approaches:

    • Computational modeling: Building models that account for differences in experimental systems

    • Correlation analysis: Establishing relationships between in vitro measurements and in vivo phenotypes

    • Validation using genetic approaches: When possible, generating transgenic orchids with modified atpI to confirm in vitro findings

In practical terms, researchers should treat recombinant protein studies as providing mechanistic insights that require validation in more complex systems. The temperature-responsive studies of Phalaenopsis genes provide an example of how environmental factors can significantly influence protein expression and function in vivo, which may not be captured in simplified in vitro systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.