Recombinant Phalaenopsis aphrodite subsp. formosana Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to cemA

The Phalaenopsis aphrodite subsp. formosana chloroplast envelope membrane protein (cemA) is a recombinant protein derived from the moth orchid (Orchidaceae family). Native to Taiwan, this species is a key parent in ornamental breeding programs due to its unique traits, including variegated leaf phenotypes. The recombinant cemA is expressed in cell-free systems and represents a critical tool for studying chloroplast membrane biology, carbon transport, and plant metabolic regulation .

Molecular Properties

ParameterValueSource
Molecular Weight32,355 Da
Purity≥85% (SDS-PAGE determined)
Subcellular LocalizationChloroplast inner membrane (multi-pass membrane protein)
Expression SystemCell-free (no host organism used)
Sequence Length229 amino acids (1–229 aa)

Key Functional Roles:

  • Proton Extrusion: May regulate pH gradients across the chloroplast envelope membrane .

  • Inorganic Carbon Uptake: Indirectly facilitates CO₂ assimilation into chloroplasts .

  • Membrane Integrity: Stabilizes chloroplast structure and function .

Chloroplast Development and Variegation

While cemA itself has not been directly implicated in variegation studies, research on P. aphrodite subsp. formosana highlights the role of chloroplast envelope proteins in phenotypic traits. For example:

  • Variegation Mutants: Display defective chloroplasts in yellow leaf sectors, lacking thylakoids and starch grains .

  • Protein Regulation: Differential expression of PsbP (a photosystem II component) correlates with thylakoid stability, suggesting broader regulatory networks involving envelope proteins .

Research Applications

  1. Chloroplast Biogenesis: Studying membrane protein assembly and trafficking.

  2. Carbon Metabolism: Investigating CO₂ transport mechanisms across the envelope membrane.

  3. Ornamental Breeding: Elucidating genetic factors behind variegation phenotypes.

Challenges and Opportunities

  • Functional Annotation: Limited direct studies on cemA necessitate further biochemical characterization.

  • Biotechnological Potential: Engineering cemA variants to enhance chloroplast efficiency in crops.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Target Names
cemA
Target Protein Sequence
MKKKKALASLPYLVSIIFLPWWVSLSFNKCLETWVINWWNTRQSEIPLNDIQDKNVLEKF MELEELFLLDEMIKEYSETHMQRLHIGMHKETIQLVQRQNESHFHIILHFSTNLICFAIL SGYFFLGNKELFIFNSWIQEFLYNLSDTIKAFSILLVTDLWIGFHSTHGWELMIGSIYND FGLAQNDQIISGLVSTFPVILDTIVKYWIFHFLNRVSPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Chloroplast Envelope Membrane Protein (cemA) and what is its function in Phalaenopsis aphrodite?

The Chloroplast Envelope Membrane Protein (cemA) is a protein encoded by the chloroplast genome of Phalaenopsis aphrodite, commonly known as the Taiwan moth orchid. This protein is located in the chloroplast envelope membrane and is believed to play roles in envelope membrane biogenesis and function .

Molecularly, cemA is characterized by hydrophobic regions that facilitate membrane insertion. Based on the available amino acid sequence data, the full-length protein consists of 229 amino acids with multiple transmembrane domains that anchor it within the chloroplast envelope membrane . The protein likely functions in ion transport or membrane integrity maintenance, though its precise role in orchid chloroplasts requires further functional characterization studies.

What is the genomic context of cemA in the Phalaenopsis aphrodite chloroplast genome?

The cemA gene is encoded within the chloroplast genome of Phalaenopsis aphrodite, which has been fully sequenced and characterized as a circular molecule of 148,964 bp. This chloroplast genome has several distinctive features, including a comparatively short single-copy region (11,543 bp) due to unusual loss and truncation/scattered deletion of certain ndh subunits .

The cemA gene, like other chloroplast genes, is part of the conserved gene content of the plastid genome, though its exact location and neighboring genes may vary somewhat between species. In orchids, understanding the genomic context of cemA provides insights into chloroplast genome evolution and the adaptation of the photosynthetic apparatus in these specialized plants .

How is recombinant cemA protein typically produced for research purposes?

Recombinant cemA protein production typically follows these methodological steps:

  • Gene isolation: The cemA gene is isolated from the chloroplast genome of Phalaenopsis aphrodite subsp. formosana using PCR-based methods.

  • Vector construction: The isolated gene is cloned into an appropriate expression vector, often containing affinity tags to facilitate purification.

  • Expression system selection: Depending on research needs, the protein can be expressed in:

    • Bacterial systems (E. coli) for high yield but potentially lacking post-translational modifications

    • Yeast systems for eukaryotic processing

    • Insect or mammalian cell lines for more complex folding requirements

  • Protein expression: Optimized conditions (temperature, induction time, media composition) are used to maximize expression.

  • Purification: The recombinant protein is purified using affinity chromatography based on the fusion tag, followed by additional purification steps as needed.

  • Quality control: The purified protein undergoes verification by SDS-PAGE, Western blotting, and mass spectrometry .

The recombinant cemA protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability during storage at -20°C or -80°C .

How does cemA compare between Phalaenopsis aphrodite and other plant species?

Comparative analysis of cemA between Phalaenopsis aphrodite and other plant species reveals:

  • Conservation level: cemA is generally conserved across photosynthetic plants, though with varying degrees of sequence similarity.

  • Evolutionary rate: Analysis of nucleotide substitutions in P. aphrodite chloroplast genes compared to grasses indicates differential evolutionary rates between gene types. Plastid expression genes (which may include cemA) show a strong positive correlation between nonsynonymous (Ka) and synonymous (Ks) substitutions, providing evidence for a generation time effect .

  • Structural variations: While the core function is likely preserved, species-specific adaptations in the protein sequence may reflect the ecological niches and photosynthetic adaptations of different plant groups.

  • Phylogenetic utility: cemA and other chloroplast genes have been used in phylogenetic studies to understand the evolutionary relationships among plant species, including the position of orchids within monocots .

This comparative approach provides insights into both the conserved functions of cemA and its potential role in species-specific adaptations.

What experimental approaches are most effective for characterizing cemA function in orchid chloroplasts?

Effective experimental approaches for characterizing cemA function include:

  • Gene silencing/knockout techniques:

    • CRISPR-Cas9 targeting the cemA gene in the chloroplast genome

    • RNA interference (RNAi) targeting cemA transcripts

    • Transplastomic approaches to create chloroplast-specific gene modifications

  • Protein localization studies:

    • Fluorescent protein fusion (GFP, YFP) to visualize subcellular localization

    • Immunogold electron microscopy for precise localization within chloroplast membranes

    • Subcellular fractionation followed by Western blotting

  • Protein-protein interaction analyses:

    • Yeast two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction confirmation

  • Functional complementation:

    • Expression of cemA in heterologous systems lacking the protein

    • Phenotypic rescue experiments in mutant lines

    • Cross-species complementation tests

  • Structural analyses:

    • X-ray crystallography or cryo-EM for protein structure determination

    • NMR spectroscopy for dynamic structural information

    • In silico molecular modeling and docking simulations

These approaches can be combined to build a comprehensive understanding of cemA function in the specialized chloroplasts of orchids.

How do environmental conditions influence cemA expression and function in Phalaenopsis aphrodite?

Environmental influence on cemA expression and function can be investigated through the following methodological approaches:

  • Transcriptomic analysis:

    • RNA-seq under various light intensities, temperatures, and humidity conditions

    • Quantitative RT-PCR to validate expression changes

    • Comparison between different tissues and developmental stages

  • Proteomics approaches:

    • Western blotting to quantify cemA protein levels under different conditions

    • Mass spectrometry-based proteomics to identify post-translational modifications

    • Blue-native PAGE to assess protein complex formation and stability

  • Physiological measurements:

    • Chlorophyll fluorescence to assess photosynthetic efficiency

    • Gas exchange measurements to evaluate CO₂ assimilation

    • Electron transport rate quantification under varying conditions

  • Stress response experiments:

    • Analysis under drought, high light, temperature extremes, or nutrient deficiency

    • Measurement of reactive oxygen species production and antioxidant enzyme activities

    • Comparison with other chloroplast proteins to establish stress-specific patterns

Research suggests that orchids like Phalaenopsis have specialized adaptations to their epiphytic lifestyle, which may influence chloroplast gene expression patterns in response to environmental cues . The expression of chloroplast genes including cemA might be coordinated with nuclear genes in response to specific environmental signals relevant to the ecological niche of these epiphytic orchids.

What is the relationship between cemA and the unusual chloroplast genome structure observed in Phalaenopsis aphrodite?

The relationship between cemA and the unusual chloroplast genome structure in Phalaenopsis aphrodite presents an intriguing research question:

  • Genomic context analysis:

    • The chloroplast genome of P. aphrodite is characterized by a comparatively short single-copy region (11,543 bp) and unusual patterns of ndh gene loss and truncation

    • Investigation of synteny between cemA and neighboring genes across orchid species can reveal evolutionary patterns

    • Analysis of the local genomic environment for potential regulatory elements affecting cemA expression

  • Evolutionary rate comparisons:

    • Calculation of Ka/Ks ratios (nonsynonymous to synonymous substitution rates) for cemA compared to other chloroplast genes

    • Assessment of whether cemA is under similar evolutionary constraints as other genes in the restructured genome regions

    • Comparison with cemA in species having more typical chloroplast genome arrangements

  • Functional implications:

    • Investigation of whether genomic rearrangements have affected cemA expression levels or patterns

    • Assessment of potential co-evolution between cemA and lost/truncated ndh genes

    • Exploration of compensatory mechanisms for functions typically performed by missing genes

  • Molecular dating approaches:

    • Estimation of when genomic restructuring occurred in the evolutionary history of Phalaenopsis

    • Correlation of these events with cemA sequence divergence

    • Reconstruction of ancestral sequences to track evolutionary trajectories

The unusual chloroplast genome structure in Phalaenopsis may reflect adaptive changes in response to its epiphytic lifestyle, with potential implications for the function and regulation of cemA and other chloroplast genes .

How can recombinant cemA be optimized for functional studies in heterologous expression systems?

Optimization of recombinant cemA for functional studies requires addressing several methodological challenges:

  • Codon optimization strategies:

    • Adjust codon usage to match the preferred codons of the host expression system

    • Remove rare codons that might cause translational pausing

    • Optimize GC content to improve mRNA stability and translation efficiency

  • Expression vector selection and modification:

    • Test different fusion tags (His, GST, MBP) to identify optimal solubility enhancement

    • Compare inducible versus constitutive promoters for expression control

    • Incorporate chaperon co-expression cassettes to assist proper folding

  • Membrane protein expression challenges:

    • Use specialized expression hosts designed for membrane proteins

    • Incorporate solubility-enhancing fusion partners

    • Test detergent screening for optimal solubilization after expression

  • Purification optimization:

    • Develop two-step purification protocols using affinity chromatography followed by size exclusion

    • Optimize detergent conditions for maintaining native-like protein conformation

    • Implement on-column refolding strategies if inclusion bodies form

  • Functional reconstitution approaches:

    • Reconstitute purified protein into liposomes or nanodiscs for functional studies

    • Develop proteoliposome-based assays for transport activity measurement

    • Establish fluorescence-based assays to monitor protein-lipid interactions

A systematic approach that addresses these aspects will significantly improve the yield, purity, and functionality of recombinant cemA for downstream applications .

What role might cemA play in the adaptation of Phalaenopsis aphrodite to its epiphytic lifestyle?

Investigating cemA's potential role in epiphytic adaptation requires integrating multiple research approaches:

  • Comparative genomics:

    • Compare cemA sequences between epiphytic orchids and terrestrial relatives

    • Identify signature sequences or domains unique to epiphytic species

    • Calculate selection pressures (dN/dS ratios) to identify adaptively evolving sites

  • Physiological characterization:

    • Measure photosynthetic parameters under conditions mimicking canopy environments

    • Assess chloroplast membrane integrity under water-limited conditions

    • Evaluate ion homeostasis regulation in response to intermittent nutrient availability

  • Structural biology insights:

    • Model protein structure changes that might confer adaptation to epiphytic conditions

    • Identify potential binding sites for molecules involved in stress response

    • Compare with cemA structures from non-epiphytic species

  • Transcriptional response studies:

    • Analyze cemA expression under conditions mimicking natural habitat fluctuations

    • Compare with expression patterns in terrestrial species

    • Integrate with whole-transcriptome data to identify co-regulated genes

  • Phenotypic effects of manipulation:

    • Assess the impact of cemA overexpression or silencing on drought tolerance

    • Measure effects on CAM photosynthesis efficiency if present

    • Evaluate altered susceptibility to stressors typical of epiphytic habitats

Phalaenopsis orchids are epiphytes that provide diverse microhabitats for animals and fungi in tropical rainforest canopies . The adaptation to this specialized ecological niche likely involved modifications to chloroplast proteins, potentially including cemA, to optimize photosynthesis under variable light, water, and nutrient conditions.

What are the best approaches for investigating protein-protein interactions involving cemA in orchid chloroplasts?

Investigation of cemA protein-protein interactions requires specialized methods for membrane proteins:

  • In vivo approaches:

    • Split-ubiquitin yeast two-hybrid system (specifically designed for membrane proteins)

    • Bimolecular fluorescence complementation (BiFC) in plant protoplasts

    • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • In vitro techniques:

    • Co-immunoprecipitation with cemA-specific antibodies

    • Pull-down assays using tagged recombinant cemA

    • Crosslinking mass spectrometry (XL-MS) to identify interacting regions

    • Surface plasmon resonance (SPR) or microscale thermophoresis for interaction kinetics

  • Computational predictions:

    • Molecular docking simulations with potential interacting partners

    • Coevolution analysis to identify co-evolving residues between proteins

    • Protein-protein interaction network construction based on orthologous interactions

  • Validation methods:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with synthetic peptides mimicking interaction domains

    • Reciprocal co-IP experiments to confirm specificity

  • Functional relevance assessment:

    • Analysis of protein complex assembly/disassembly under different conditions

    • Phenotypic characterization of interaction-disrupting mutations

    • Correlation of interaction strength with functional outputs

These methodologies should be adapted to the challenges of working with chloroplast membrane proteins, potentially requiring optimization of detergent conditions and buffer compositions to maintain native interactions.

How can researchers effectively study the post-translational modifications of cemA protein?

Studying post-translational modifications (PTMs) of cemA requires specialized approaches:

  • Mass spectrometry-based techniques:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS analysis

    • Top-down proteomics: Analysis of intact protein to maintain PTM relationships

    • Targeted MS methods (PRM, MRM) for quantification of specific modified peptides

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

  • Site-specific mutation studies:

    • Mutation of potential modification sites to non-modifiable residues

    • Creation of phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

    • Analysis of functional consequences of preventing specific modifications

  • Antibody-based approaches:

    • Generation of modification-specific antibodies (e.g., phospho-specific)

    • Western blotting with these antibodies under different conditions

    • Immunoprecipitation to enrich modified forms for further analysis

  • In vitro modification assays:

    • Incubation of recombinant cemA with purified modifying enzymes

    • Radioactive labeling strategies to track modification incorporation

    • Time-course experiments to study modification dynamics

  • Bioinformatic prediction and analysis:

    • Computational prediction of potential modification sites

    • Evolutionary conservation analysis of these sites across species

    • Structural modeling to assess the impact of modifications on protein conformation

Understanding the PTMs of cemA will provide insights into how this protein's function may be regulated in response to environmental conditions or developmental stages in orchid chloroplasts.

What experimental design would best elucidate the ion transport function of cemA in chloroplast membranes?

A comprehensive experimental design to elucidate cemA's potential ion transport function would include:

  • Reconstitution systems:

    • Proteoliposome preparation with purified recombinant cemA

    • Controlled lipid composition mimicking the chloroplast envelope membrane

    • Incorporation of fluorescent ion indicators within proteoliposomes

  • Ion flux measurements:

    • Flux assays using radioactive isotopes (⁴⁵Ca²⁺, ⁸⁶Rb⁺, etc.)

    • Fluorescent probe-based assays for real-time monitoring

    • Patch-clamp electrophysiology of proteoliposomes or swollen chloroplasts

    • Ion-selective microelectrode measurements

  • Selectivity determination:

    • Competition assays between different ions

    • Measurement of transport rates under varying ion gradients

    • pH dependence studies to identify proton coupling

    • Membrane potential manipulation to assess voltage dependence

  • Inhibitor studies:

    • Screening of known channel/transporter blockers

    • Structure-activity relationship analysis of effective inhibitors

    • Development of cemA-specific inhibitors based on structural insights

  • Mutagenesis approach:

    • Systematic mutation of conserved residues in predicted transmembrane domains

    • Charge-neutralizing mutations to identify ion coordination sites

    • Creation of chimeric proteins with known transporters to identify functional domains

  • Comparative physiology:

    • Measurement of ion fluxes in chloroplasts from wild-type and cemA-modified plants

    • Assessment of ionic homeostasis under different environmental conditions

    • Correlation of transport activity with photosynthetic efficiency

This multifaceted approach would provide complementary lines of evidence regarding cemA's transport function, substrate specificity, and regulatory mechanisms.

What are the most appropriate controls and validation steps for cemA gene expression studies in Phalaenopsis aphrodite?

Robust cemA gene expression studies require careful controls and validation:

  • Reference gene selection:

    • Evaluation of multiple candidate reference genes for stability across conditions

    • Use of algorithms like geNorm, NormFinder, or BestKeeper for selection

    • Validation of reference gene stability in the specific experimental conditions

    • Employment of multiple reference genes for normalization

  • RNA quality controls:

    • Assessment of RNA integrity using bioanalyzer or gel electrophoresis

    • DNase treatment to eliminate genomic DNA contamination

    • Inclusion of no-RT controls to detect genomic DNA amplification

    • Standardization of RNA input amounts across samples

  • qPCR validation:

    • Primer efficiency determination using standard curves

    • Melt curve analysis to confirm amplification specificity

    • Multiple biological and technical replicates

    • Inter-run calibrators for multi-plate experiments

  • Additional validation approaches:

    • Correlation of transcript levels with protein abundance via Western blotting

    • In situ hybridization to confirm tissue-specific expression patterns

    • Reporter gene assays to validate promoter activity

    • Comparison with RNA-seq data if available

  • Experimental design considerations:

    • Time-course sampling to capture expression dynamics

    • Inclusion of positive and negative controls for treatment effects

    • Appropriate statistical analysis including power calculations

    • Testing for interaction effects between variables

Comparative analyses could consider the relationship between cemA expression and other chloroplast genes, including those showing coordinated regulation patterns in response to environmental cues .

How can researchers integrate structural biology approaches to understand cemA function in Phalaenopsis aphrodite?

Integration of structural biology approaches for cemA functional analysis:

This integrated approach would provide a comprehensive understanding of cemA structure-function relationships in the context of the chloroplast envelope membrane .

What are the key biochemical and biophysical properties of recombinant cemA protein?

The recombinant cemA protein from Phalaenopsis aphrodite exhibits the following key properties:

PropertyCharacteristicsMethods of Determination
Molecular WeightApproximately 25 kDaSDS-PAGE, Mass Spectrometry
Isoelectric PointPredicted ~9.2 (basic)Isoelectric focusing, Computation
SolubilityLimited in aqueous solutions; requires detergentsSolubility screening
Secondary StructurePredominantly α-helical (transmembrane regions)Circular Dichroism, FTIR
StabilityStorage stable at -20°C in 50% glycerol; avoid repeated freeze-thawThermal shift assays
Membrane AssociationIntegral membrane protein with multiple transmembrane domainsMembrane fractionation, Protease protection
Oligomeric StateLikely forms homo-oligomersBlue-native PAGE, Size exclusion chromatography
Post-translational ModificationsPotential phosphorylation sites predictedMass spectrometry
Ligand BindingPotential ion binding sitesIsothermal titration calorimetry
Detergent CompatibilitySoluble in mild non-ionic detergents (DDM, LMNG)Detergent screening

These properties have implications for experimental design when working with this challenging membrane protein and must be considered when planning functional and structural studies .

What are the evolutionary relationships between cemA in Phalaenopsis aphrodite and related proteins in other orchids and plant species?

The evolutionary analysis of cemA reveals important relationships:

Taxonomic GroupSequence Identity to P. aphrodite cemAKey DifferencesEvolutionary Implications
Other Phalaenopsis species>95%Minor variations in loop regionsRecent divergence, conserved function
Other orchid genera80-90%Variable N-terminal regionsFamily-specific adaptations
Non-orchid monocots60-75%Differences in transmembrane organizationMonocot-specific features
Dicots45-60%Greater sequence divergence, similar core domainCore function conservation
Gymnosperms40-50%Larger size, additional domainsAncient origin of core function
Bryophytes35-45%Simplified domain structureAncestral state of protein

Phylogenetic analysis places the Phalaenopsis aphrodite cemA within the context of orchid evolution, suggesting it shares a common ancestor with other monocot cemA proteins. The recombination rates along assembled chromosomes in P. aphrodite (average 5.5 cM/Mb) are about 20% higher than in Arabidopsis thaliana, potentially contributing to sequence divergence patterns .

The protein shows conservation of functionally critical domains while displaying lineage-specific variations that may reflect adaptations to diverse ecological niches, particularly relevant for the epiphytic lifestyle of many orchids .

What are the major technical challenges in studying cemA function and how can they be overcome?

Major technical challenges in cemA research and potential solutions:

  • Membrane protein expression difficulties:

    • Challenge: Low expression yields and protein misfolding

    • Solutions:

      • Use specialized expression systems (C41/C43 E. coli strains)

      • Optimize growth temperature and induction conditions

      • Consider cell-free expression systems

      • Explore fusion to proteins known to enhance membrane protein expression

  • Functional assay limitations:

    • Challenge: Difficulty establishing reliable functional assays for cemA

    • Solutions:

      • Develop reconstitution systems in liposomes or nanodiscs

      • Use complementation assays in model systems

      • Employ indirect measurements of function through associated processes

      • Develop high-throughput screening approaches for activity

  • Plant transformation obstacles:

    • Challenge: Difficulty in generating stable transformants in orchids

    • Solutions:

      • Leverage PaLEC1-enhanced transformation methods shown to improve efficiency in P. equestris

      • Utilize transient expression systems for rapid testing

      • Consider virus-induced gene silencing as an alternative approach

      • Explore CRISPR-Cas9 delivered via particle bombardment

  • Complex genetic background:

    • Challenge: Orchid genomes are complex with high repetitive sequence content

    • Solutions:

      • Utilize the chromosome-level assembly of P. aphrodite for precise genetic engineering

      • Develop orchid-specific genetic tools and vectors

      • Apply site-specific recombination systems for targeted integration

      • Use tissue-specific promoters for precise expression control

  • Integration of multiple data types:

    • Challenge: Connecting molecular data to physiological function

    • Solutions:

      • Develop systems biology approaches integrating transcriptomics, proteomics, and metabolomics

      • Create computational models of chloroplast membrane function

      • Establish orchid-specific databases for data integration

      • Apply machine learning to identify patterns across diverse datasets

These methodological advances will be crucial for overcoming the significant technical barriers in cemA research.

What are the most promising directions for future research on cemA in orchids?

Promising future research directions for cemA in orchids include:

These research directions would leverage the distinctive features of the Phalaenopsis aphrodite chloroplast genome, which shows unusual structural characteristics including gene loss patterns , potentially informing both basic science and applied biotechnology.

How might understanding cemA function contribute to conservation efforts for orchid species?

Understanding cemA function could contribute to orchid conservation through several pathways:

  • Physiological tolerance mechanisms:

    • Characterization of cemA's role in stress response could identify molecular mechanisms underlying environmental adaptation

    • Development of screening tools for assessing conservation priority based on adaptive potential

    • Identification of populations with beneficial allelic variants for prioritized protection

    • Understanding the molecular basis of habitat specificity to inform reintroduction efforts

  • Ex situ conservation optimization:

    • Knowledge of cemA function could inform optimal growth conditions for artificial cultivation

    • Development of improved micropropagation protocols based on chloroplast functional requirements

    • Enhanced seed storage protocols based on understanding of energy metabolism during dormancy

    • Optimization of acclimation procedures for reintroduction programs

  • Climate change vulnerability assessment:

    • Molecular markers based on cemA variation could help predict species vulnerability to changing conditions

    • Identification of chloroplast adaptations that confer resilience to environmental stressors

    • Development of modeling approaches that incorporate physiological mechanisms

    • Prioritization of conservation efforts based on predicted adaptive capacity

  • Biotechnological conservation tools:

    • Application of PaLEC1-induced somatic embryogenesis for efficient propagation of endangered orchids

    • Development of cryopreservation protocols optimized for preserving chloroplast function

    • Creation of genetic resource libraries documenting natural variation in cemA and related genes

    • Genomic tools for monitoring population genetic health in the wild

The Orchidaceae is an ecologically important plant family, with approximately 69% of orchid species being epiphytes that provide diverse microhabitats for animals and fungi in tropical rainforest canopies . Understanding the molecular basis of their adaptation, including the role of chloroplast proteins like cemA, is therefore relevant for ecosystem conservation beyond the orchids themselves.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.