Recombinant Phalaenopsis aphrodite subsp. formosana Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Cytochrome b6 (petB) is a core subunit of the cytochrome b6-f complex, essential for electron transfer between Photosystem II and I in chloroplasts . The recombinant version produced from Phalaenopsis aphrodite subsp. formosana (moth orchid) enables functional and structural studies of this photosynthetic machinery.

Production and Purification

  • Expression System: Escherichia coli

  • Purity: >85% (SDS-PAGE)

  • Storage:

    • Lyophilized powder stable at -20°C/-80°C for 12 months

    • Reconstituted in Tris-based buffer with 50% glycerol

  • Reconstitution: Sterile water to 0.1–1.0 mg/mL; glycerol recommended for long-term storage

Research Applications

  • Electron Transport Studies: Used to investigate proton gradient formation in ATP synthesis .

  • Structural Biology: Facilitates cryo-EM and X-ray crystallography of the cytochrome b6-f complex .

  • Plant Adaptation Research: petB shows positive selection signatures in terrestrial orchids, linked to photosynthetic efficiency under varying light conditions .

Functional Insights from Genomic Studies

  • RNA Editing: Plastid petB undergoes C-to-U RNA editing at two sites in Ophrys orchids, likely optimizing protein function .

  • Evolutionary Conservation: High sequence homology with Phalaenopsis aphrodite plastid genes supports its role in adaptation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement in the order notes. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the relationship between Cytochrome b6 (petB) and the Cytochrome b6/f complex in Phalaenopsis aphrodite?

Cytochrome b6 (encoded by petB) serves as a fundamental component of the Cytochrome b6/f complex in Phalaenopsis aphrodite subsp. formosana. It forms a critical subcomplex with PetD (Cytochrome b6-f complex subunit 4) that exhibits mild protease resistance. This subcomplex functions as an essential template for the subsequent assembly of other components, including Cytochrome f and PetG, ultimately producing a protease-resistant cytochrome moiety . The structural integrity of this complex is vital for chloroplast function and energy transfer within the photosynthetic pathway.

How does Cytochrome b6 interact with other subunits of the b6/f complex?

Cytochrome b6 directly interacts with PetD to form the initial subcomplex in the assembly pathway of the Cytochrome b6/f complex. This interaction is crucial, as PetD exhibits significant instability in the absence of Cytochrome b6. Furthermore, the synthesis of Cytochrome f is substantially reduced when either Cytochrome b6 or PetD is inactivated, indicating both are prerequisites for proper Cytochrome f synthesis . The assembly process continues with the addition of Cytochrome f and PetG to the b6-PetD subcomplex, followed by PetC and PetL proteins, which contribute to the formation of the functional dimer structure of the complete complex .

What is the standard protocol for expressing recombinant Cytochrome b6 from Phalaenopsis aphrodite?

For recombinant expression of Cytochrome b6 from Phalaenopsis aphrodite subsp. formosana, researchers typically utilize E. coli expression systems with N-terminal His-tagging, similar to the approach used for related proteins such as PetD . The expression protocol includes:

  • Gene cloning into an appropriate expression vector

  • Transformation into E. coli expression strain

  • Induction of protein expression

  • Cell lysis and initial purification

  • Affinity chromatography using the His-tag

  • Further purification steps as needed

  • Lyophilization for storage

The purified protein is typically stored as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and should be reconstituted to 0.1-1.0 mg/mL in deionized sterile water prior to experimental use .

What are the optimal conditions for storage and reconstitution of recombinant Cytochrome b6 proteins?

Optimal storage conditions for recombinant Cytochrome b6 proteins, similar to related proteins in the complex such as PetD, include:

Storage ParameterRecommended Condition
Long-term storage-20°C to -80°C
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
AliquotingNecessary to avoid repeated freeze-thaw cycles
Glycerol concentration5-50% (final concentration)
Working temperature4°C for up to one week
Reconstitution concentration0.1-1.0 mg/mL in deionized sterile water

Before opening storage vials, brief centrifugation is recommended to bring contents to the bottom. Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity .

How can researchers verify the proper folding and function of recombinant Cytochrome b6?

Verification of proper folding and function of recombinant Cytochrome b6 can be achieved through multiple complementary approaches:

  • Spectroscopic analysis: UV-visible spectroscopy to verify characteristic absorption peaks of the heme groups.

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): To assess the formation of monomers, dimers, and intermediate complexes. In properly functioning samples, you should observe distinct bands for both monomers and dimers, with appropriate ratios between them. Comparative analysis with wild-type samples can reveal abnormalities in complex formation .

  • Immunoprecipitation and pulse-chase labeling: To evaluate protein synthesis rates and stability. This approach can identify defects in protein synthesis and assembly by comparing the incorporation of radioactive labels over different time intervals (e.g., 10 min vs. 30 min pulses) .

  • Western blot analysis: Using specific antibodies against Cytochrome b6 to confirm protein expression and stability.

  • Functional assays: Measuring electron transport activity to verify the proper function of the reconstituted protein.

What approaches can be used to study the assembly process of the Cytochrome b6/f complex?

The assembly process of the Cytochrome b6/f complex can be studied using several sophisticated approaches:

  • Blue Native PAGE analysis: This technique allows visualization of the different assembly states, including monomers, dimers, and intermediate complexes. When analyzing mutants with assembly defects, researchers should look for altered ratios between these forms. For instance, in the DAC mutant, an increased level of intermediates relative to monomers and dimers indicates assembly disruption .

  • Pulse-chase labeling: This method enables tracking of newly synthesized proteins and their assembly into complexes. By varying pulse durations (e.g., 10 min vs. 30 min), researchers can distinguish between synthesis defects and stability issues. A comparative analysis between wild-type and mutant samples provides insights into assembly kinetics .

  • Polysome profiling: This technique analyzes ribosomal loading of specific mRNAs, revealing alterations in translation efficiency that might affect complex assembly.

  • Immunoprecipitation with complex-specific antibodies: This approach helps identify interacting partners during different stages of assembly .

  • Protein crosslinking: This method captures transient interactions during the assembly process.

How does the dysfunction of Cytochrome b6 affect chloroplast development in Phalaenopsis aphrodite?

Dysfunction of Cytochrome b6 significantly impacts chloroplast development in Phalaenopsis aphrodite subsp. formosana, particularly affecting thylakoid organization and function. When the Cytochrome b6/f complex is compromised, it disrupts electron transport between photosystems II and I, ultimately affecting ATP synthesis and carbon fixation.

The interdependence of these components is further demonstrated by the observation that defects in the Cytochrome b6/f complex can lead to chlorophyll deficiency, as seen in the yellow sectors of variegated leaves, where chloroplasts fail to develop properly .

What methods can be used to investigate the protein-protein interactions of Cytochrome b6 in vivo?

Several sophisticated methods can be employed to investigate protein-protein interactions of Cytochrome b6 in vivo:

  • Co-immunoprecipitation (Co-IP): Using specific antibodies against Cytochrome b6 to pull down the protein along with its interacting partners, followed by mass spectrometry identification.

  • Bimolecular Fluorescence Complementation (BiFC): This technique involves fusing potential interacting proteins with complementary fragments of a fluorescent protein. When the proteins interact, the fragments come together to form a functional fluorescent protein, allowing visualization of the interaction in living cells.

  • Förster Resonance Energy Transfer (FRET): By tagging Cytochrome b6 and potential interacting partners with appropriate fluorophores, energy transfer between fluorophores can indicate close proximity and likely interaction.

  • Split-ubiquitin assay: A yeast-based method particularly useful for membrane proteins like Cytochrome b6.

  • Two-dimensional electrophoresis coupled with mass spectrometry: This approach can identify differential protein expression patterns and potential interaction partners, as demonstrated in studies of variegated leaves of Phalaenopsis aphrodite .

  • Blue Native PAGE followed by second-dimension SDS-PAGE: This technique separates intact protein complexes in the first dimension and their constituent subunits in the second dimension, providing insights into complex formation and stability .

What are the implications of Cytochrome b6 research for understanding variegation in Phalaenopsis?

Research on Cytochrome b6 and the broader b6/f complex has significant implications for understanding variegation in Phalaenopsis aphrodite subsp. formosana:

  • Photosynthetic machinery integrity: As a critical component of the electron transport chain, disruptions in Cytochrome b6 function can affect chloroplast development and function, potentially contributing to variegation phenotypes.

  • Integration with other photosynthetic components: Studies in variegated Phalaenopsis mutants have shown that defects in the oxygen-evolving complex proteins (PsbP and PsbO) correlate with variegation patterns . The functional relationship between these proteins and the Cytochrome b6/f complex suggests an integrated network of factors controlling chloroplast development.

  • Post-transcriptional regulation: Research has revealed that differential expression of photosynthetic components between green and yellow sectors is not primarily at the transcriptional level but involves alternative splicing and other post-transcriptional mechanisms . Similar regulatory mechanisms might affect Cytochrome b6 expression and function.

  • Viral interactions: The differential expression of CymMV (Cymbidium mosaic virus) between green and yellow sectors suggests a potential link between viral infection and variegation . This opens avenues for investigating virus-host interactions affecting Cytochrome b6 and other photosynthetic components.

How can differential proteomics be applied to understand the role of Cytochrome b6 in variegated Phalaenopsis leaves?

Differential proteomics offers powerful approaches to elucidate the role of Cytochrome b6 in variegated Phalaenopsis leaves:

  • Two-dimensional electrophoresis (2-DE) coupled with LC/MS/MS: This technique has successfully revealed differential expression of photosynthetic proteins (PsbP and PsbO) between green and yellow leaf sectors . A similar approach can be applied to investigate Cytochrome b6 expression patterns across different leaf regions.

  • Quantitative proteomics using isotope labeling: Techniques such as iTRAQ (isobaric tags for relative and absolute quantitation) or SILAC (stable isotope labeling with amino acids in cell culture) can provide precise quantification of protein expression differences.

  • Phosphoproteomics analysis: This approach can identify potential regulatory post-translational modifications of Cytochrome b6 and associated proteins that might differ between green and yellow sectors.

  • Protein-protein interaction networks: Using pull-down assays followed by mass spectrometry to identify interacting partners of Cytochrome b6 in different leaf sectors, revealing potential functional differences.

  • Comparative analysis of protein complex assembly: Using Blue Native PAGE coupled with mass spectrometry to compare the assembly state of the Cytochrome b6/f complex between green and yellow sectors.

The integration of these proteomics approaches with transcriptomic data can provide comprehensive insights into how Cytochrome b6 expression, modification, and complex formation vary across variegated leaves, potentially identifying key regulatory mechanisms .

What are the current challenges in studying alternative splicing of genes encoding Cytochrome b6/f complex components in Phalaenopsis?

Several significant challenges exist in studying alternative splicing of genes encoding Cytochrome b6/f complex components in Phalaenopsis:

  • Limited genomic resources: Despite recent advances, the complete genomic sequence for Phalaenopsis aphrodite subsp. formosana remains partially characterized, complicating the identification of all potential splice variants.

  • Complex orchid gene structures: Orchid genes often contain numerous introns and exhibit complex splicing patterns, making comprehensive analysis difficult.

  • Detection of low-abundance transcripts: Alternative splice variants may be expressed at low levels, requiring highly sensitive detection methods.

  • Distinguishing functional significance: Determining whether detected splice variants produce functional proteins or represent splicing noise presents a major challenge.

  • Tissue-specific and condition-dependent splicing: Alternative splicing patterns may vary across tissues, developmental stages, and environmental conditions, necessitating comprehensive sampling strategies.

Based on findings in related studies, alternative polyadenylation (APA) has been observed to occur within intron regions of photosynthetic genes like PsbP, leading to mutant transcripts . Similar mechanisms might affect Cytochrome b6 gene processing, requiring specialized approaches to detect and characterize these variants fully.

How might CRISPR/Cas9 genome editing be applied to study Cytochrome b6 function in Phalaenopsis?

CRISPR/Cas9 genome editing offers transformative approaches to study Cytochrome b6 function in Phalaenopsis aphrodite:

  • Gene knockout studies: Creating complete or conditional knockouts of the petB gene to assess the phenotypic consequences and compensatory mechanisms.

  • Domain-specific mutations: Introducing precise mutations in functional domains to understand structure-function relationships without completely eliminating the protein.

  • Promoter modifications: Altering regulatory regions to study transcriptional control mechanisms of petB expression.

  • Tagging endogenous proteins: Adding reporter tags to the native petB gene to monitor expression, localization, and interactions without overexpression artifacts.

  • Creating variegation models: Inducing mosaic knockout patterns to mimic natural variegation and study sector-specific effects.

While Phalaenopsis transformation presents technical challenges, recent advances in genetic engineering for orchids suggest feasibility. As demonstrated in studies of flower color genes in Phalaenopsis, both gene gun and Agrobacterium-mediated transformation methods can be applied . For Cytochrome b6 studies, tissue-specific or inducible systems might be particularly valuable to avoid lethal phenotypes that could result from constitutive knockout of this essential photosynthetic component.

What are promising approaches for understanding the regulatory network controlling Cytochrome b6/f complex assembly in Phalaenopsis?

Several promising approaches exist for elucidating the regulatory network controlling Cytochrome b6/f complex assembly in Phalaenopsis:

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics data to construct comprehensive regulatory networks governing Cytochrome b6/f complex assembly.

  • Identification of assembly factors: Screening for novel proteins like DAC that may be involved in the assembly/stabilization of the Cytochrome b6/f complex, potentially through interaction with Cytochrome b6 or PetD .

  • Comparative genomics across orchid species: Analyzing conservation and divergence of regulatory mechanisms across different orchid species with varying photosynthetic adaptations.

  • Analysis of post-transcriptional regulation: Investigating the role of alternative splicing, RNA editing, and microRNA-mediated regulation in controlling the expression of Cytochrome b6/f complex components .

  • Environmental response studies: Examining how environmental factors modulate the regulatory network, potentially explaining phenomena like environmental-dependent variegation.

  • Long non-coding RNA identification: Exploring the potential role of lncRNAs in orchestrating complex assembly, as they have been implicated in other aspects of chloroplast development.

The discovery that DAC is involved in the accumulation of the Cytochrome b6/f complex through possible interaction with PetD suggests that similar novel factors may exist specifically for Cytochrome b6 regulation in Phalaenopsis, representing an exciting frontier for future research.

How might synthetic biology approaches be applied to engineer Cytochrome b6 for enhanced photosynthetic efficiency in Phalaenopsis?

Synthetic biology offers innovative approaches to engineer Cytochrome b6 for enhanced photosynthetic efficiency in Phalaenopsis:

  • Optimized codon usage: Redesigning the petB gene with optimal codon usage for Phalaenopsis to enhance expression efficiency.

  • Domain swapping experiments: Creating chimeric proteins by swapping domains between Cytochrome b6 from different species to identify functional improvements.

  • Directed evolution: Applying in vitro evolution techniques to generate Cytochrome b6 variants with enhanced electron transfer capabilities.

  • Modification of regulatory elements: Engineering promoters and other regulatory regions to achieve optimal expression levels and patterns.

  • Integration with other photosynthetic enhancements: Combining Cytochrome b6 modifications with alterations to other components of the photosynthetic machinery for synergistic improvements.

  • Computational design approaches: Using structural models to predict beneficial mutations that might enhance complex stability or electron transfer efficiency.

While these approaches hold promise, they must be implemented with careful consideration of the complex interactions within the photosynthetic machinery. The interdependence of Cytochrome b6 with other components, such as PetD and Cytochrome f , necessitates a holistic approach to engineering that maintains these critical interactions while enhancing function.

What are the broader implications of Cytochrome b6 research for understanding photosynthesis in orchids?

Research on Cytochrome b6 in Phalaenopsis aphrodite subsp. formosana has broad implications for understanding photosynthesis in orchids and other plants:

  • Evolutionary adaptations: Insights into how orchids have adapted their photosynthetic machinery for diverse habitats, from epiphytic to terrestrial environments.

  • Stress response mechanisms: Understanding how the Cytochrome b6/f complex functions under various stress conditions, contributing to orchid resilience.

  • Variegation mechanisms: Elucidating the molecular basis of natural variegation, which has both ecological significance and horticultural value .

  • Photosynthetic efficiency: Identifying factors limiting photosynthetic performance in orchids, potentially leading to cultivation improvements.

  • Interplay between nuclear and chloroplast genomes: Further understanding of the coordinated expression of nuclear-encoded and chloroplast-encoded components of the photosynthetic machinery.

The discovery that post-transcriptional regulation plays a significant role in controlling photosynthetic protein expression in Phalaenopsis suggests similar mechanisms might regulate Cytochrome b6, opening new avenues for investigating the fine-tuning of photosynthesis in specialized plant groups like orchids.

How does understanding Cytochrome b6 in Phalaenopsis contribute to orchid conservation efforts?

Understanding Cytochrome b6 in Phalaenopsis contributes to orchid conservation in several significant ways:

  • Physiological requirements: Insights into the photosynthetic machinery of Phalaenopsis help determine optimal conditions for ex situ conservation programs.

  • Genetic diversity assessment: Molecular characterization of photosynthetic genes like petB provides markers for assessing genetic diversity in natural populations.

  • Climate change adaptation: Understanding how photosynthetic components respond to environmental stresses informs predictions about orchid adaptation to changing climates.

  • Hybrid vigor assessment: Molecular analysis of Cytochrome b6 and related proteins can help evaluate the photosynthetic efficiency of conservation-relevant hybrids.

  • Micropropagation optimization: Knowledge of factors affecting chloroplast development and function can improve tissue culture protocols for endangered species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.