Recombinant Phalaenopsis aphrodite subsp. formosana Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 is a core component of PSII, binding chlorophyll a and facilitating electron transfer. Key findings:

  • Structural Role: Forms a heterodimer with CP43, stabilizing the oxygen-evolving complex (OEC) and reaction center .

  • Mutant Studies:

    • In Arabidopsis, mutations in auxiliary proteins (e.g., FPB1 or PAM68) impair CP47 synthesis, leading to PSII assembly defects .

    • Variegated P. aphrodite subsp. formosana mutants exhibit reduced PsbP (OEC subunit) expression, disrupting thylakoid folding and chlorophyll accumulation .

Table 1: Genomic Features of Phalaenopsis CP47

FeatureDetailSource
Gene Length (bp)1,524 (coding sequence)
Protein Length (aa)508
Chloroplast Genome Size148,964 bp (P. aphrodite subsp. formosana)
Conserved Domains6 transmembrane helices; chlorophyll-binding sites

Research Applications

  • Photosynthesis Studies: Used to investigate PSII assembly, chlorophyll-protein interactions, and electron transport mechanisms .

  • Mutagenesis Analysis: Recombinant CP47 enables site-directed mutagenesis to probe residues critical for PSII stability .

  • Biotechnological Tools: Serves as a reference protein for optimizing chloroplast gene expression in orchids .

Key Research Findings

  • Post-Transcriptional Regulation: Alternative splicing and polyadenylation of PsbO/PsbP pre-mRNAs in P. aphrodite subsp. formosana variegated mutants correlate with CP47 destabilization .

  • Viral Interactions: Cymbidium mosaic virus (CymMV) infection exacerbates CP47 deficiency in variegated phenotypes .

  • Evolutionary Conservation: CP47 (COG5717) is conserved across 70+ species, with a median protein length of 511.79 aa .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTITNPGIWSYEGVAGAHILFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGIACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDADGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVIYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.