Recombinant Phaseolus vulgaris Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Phaseolus vulgaris (Kidney bean) (French bean)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKKGTLNVGAVLILPEGFELAPPDRISPEIKEKIGNLSFQNYRPTKKNILVVGPVPG QKYKEITFPILSPDPASKRDIHFLKYPIYVGGNRGRGQIYLDGSKSNNNVYNATAAGIVK KIIRKEKGGYEITIVDTLDEHEVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASIILAQIFLVLKKKQFEKVQLFEMNF
Uniprot No.

Target Background

Function
Recombinant Phaseolus vulgaris Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: pvu:PhvuCp37

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what role does it play in Phaseolus vulgaris?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Phaseolus vulgaris (common bean). The mature protein spans amino acids 36-320 and functions as an electron carrier between photosystem II and photosystem I. The protein contains a characteristic CXXCH motif that binds a heme group essential for its electron transfer function. When studying plant energy metabolism, this protein serves as an important marker for photosynthetic efficiency and adaptation mechanisms in different bean varieties .

The recombinant version is typically produced with a His-tag for purification purposes and expressed in E. coli expression systems to obtain sufficient quantities for experimental analysis. The full amino acid sequence (YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKKGTLNVGAVLILPEGFELAPPDRISPEIKEKIGNLSFQNYRPTKKNILVVGPVPGQKYKEITFPILSPDPASKRDIHFLKYPIYVGGNRGRGQIYLDGSKSNNNVYNATAAGIVKKIIRKEKGGYEITIVDTLDEHEVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIILAQIFLVLKKKQFEKVQLFEMNF) contains domains responsible for membrane anchoring and electron transfer functionalities .

How do genetic variants of Phaseolus vulgaris affect the expression and function of petA?

Genetic variants of Phaseolus vulgaris demonstrate significant diversity in petA expression and function. Research has revealed distinct gene pools within P. vulgaris - the Middle American ("mesoamericanus") and Andean ("andinus") pools - which show divergent evolutionary adaptations in their photosynthetic apparatus . These differences manifest in protein structure variations that affect electron transport efficiency.

When investigating petA expression, researchers must consider the germplasm origin, as crosses between Middle American and Andean cultivars often result in hybrid weakness characterized by chlorosis and developmental abnormalities . This phenomenon reflects incompatibilities in the coordinated expression of nuclear and chloroplast genes that regulate photosynthetic function. Methodologically, comparative transcriptomics and proteomics approaches are necessary to quantify these differences, with particular attention to post-transcriptional modifications that might affect cytochrome f assembly and function in different genetic backgrounds .

What are the appropriate storage and handling conditions for recombinant Phaseolus vulgaris Apocytochrome f?

For optimal experimental results, proper storage and handling of recombinant Phaseolus vulgaris Apocytochrome f is essential. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles which can compromise protein integrity . For short-term storage of working solutions, maintain aliquots at 4°C for no more than one week.

Reconstitution should follow specific protocols to maintain protein function: briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage stability, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C . The storage buffer typically consists of a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability and prevents aggregation during freeze-thaw cycles.

What are the optimal expression systems for producing recombinant Phaseolus vulgaris Apocytochrome f?

The optimal expression system for producing recombinant Phaseolus vulgaris Apocytochrome f is E. coli, which offers high yield and relative simplicity for protein production . When designing expression experiments, researchers should consider the following methodological approaches:

  • Vector Selection: Vectors containing strong inducible promoters (T7, tac) with N-terminal His-tags facilitate controlled expression and subsequent purification.

  • E. coli Strain Optimization: BL21(DE3) derivatives are preferred due to their reduced protease activity and compatibility with T7 expression systems.

  • Induction Parameters: Typically, induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, followed by expression at lower temperatures (16-25°C) for 16-20 hours improves soluble protein yield.

  • Purification Strategy: Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag provides efficient purification, with imidazole gradients for elution.

The protein's mature form spans amino acids 36-320, requiring careful design of expression constructs to exclude the transit peptide while maintaining the functional domains necessary for experimental applications . Quality control should include SDS-PAGE analysis to confirm purity (>90%) and activity assays to verify functional integrity of the purified protein.

How can researchers effectively analyze the interaction between Apocytochrome f and other components of the photosynthetic electron transport chain?

To effectively analyze interactions between Apocytochrome f and other photosynthetic electron transport chain components, researchers should employ a multi-technique approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant Apocytochrome f to pull down interacting proteins, followed by mass spectrometry identification.

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified Apocytochrome f and potential interaction partners, immobilizing one component on a sensor chip and flowing the other as analyte.

  • Fluorescence Resonance Energy Transfer (FRET): For in vivo analysis of protein-protein interactions within the intact photosynthetic apparatus, requiring fluorescent labeling of target proteins.

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding between Apocytochrome f and other components.

  • Yeast Two-Hybrid or Split-Ubiquitin Assays: For initial screening of potential interaction partners, though these require careful design for membrane proteins.

When analyzing results, researchers should account for the possibility that the His-tag may affect interaction dynamics, and consider using tag-free protein preparations for validation experiments . Additionally, native membrane environments may be crucial for physiologically relevant interactions, necessitating reconstitution into liposomes or nanodiscs for certain experiments.

What methods can be used to study the impact of mutations in the petA gene on protein structure and function?

Studying the impact of mutations in the petA gene on protein structure and function requires a systematic approach combining in silico analysis with experimental validation:

  • In Silico Analysis:

    • Homology modeling based on known cytochrome f structures

    • Molecular dynamics simulations to predict structural changes

    • Computational prediction of mutational effects on heme binding and electron transfer

  • Site-Directed Mutagenesis:

    • Creation of point mutations at conserved residues

    • Generation of deletion/insertion variants at functional domains

    • Construction of chimeric proteins to assess domain-specific functions

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure changes

    • X-ray crystallography or cryo-EM for high-resolution structural determination

    • NMR spectroscopy for dynamic structural information

  • Functional Assays:

    • Electron transfer kinetics measurements using stopped-flow spectroscopy

    • Redox potential determination via potentiometric titrations

    • Reconstitution into proteoliposomes for membrane-dependent activity assays

When interpreting results, researchers should consider the natural variation in petA sequences across different Phaseolus vulgaris accessions and mutants, which provide insights into structure-function relationships that have evolved under different environmental pressures . The cytomolecular approaches, including fluorescence in situ hybridization (FISH) and flow cytometry, can provide additional context on how mutations affect genome stability and chromosomal organization in different Phaseolus vulgaris genotypes .

How can recombinant Phaseolus vulgaris Apocytochrome f be used to study evolutionary adaptations in photosynthetic mechanisms?

Recombinant Phaseolus vulgaris Apocytochrome f represents a valuable tool for evolutionary studies of photosynthetic adaptation. To effectively utilize this protein in evolutionary research:

  • Comparative Sequence Analysis: Extract and compare petA gene sequences from diverse Phaseolus accessions representing different geographic origins. The Middle American and Andean gene pools of P. vulgaris show distinct evolutionary trajectories that influence photosynthetic efficiency .

  • Recombinant Protein Production: Express variant forms of Apocytochrome f from different genotypes using identical expression systems to ensure comparable results.

  • Functional Characterization Methodology:

    • Measure electron transfer rates under varying conditions (temperature, pH, light intensity)

    • Determine redox potential differences between variants

    • Assess stability and folding characteristics across temperature gradients

  • Integration with Phylogenetic Data: Correlate functional differences with phylogenetic relationships to identify selective pressures.

The analysis should consider that Phaseolus vulgaris demonstrates significant genome diversity based on geographic origin, with evidence of reproductive isolation between Middle American and Andean gene pools . This isolation has led to distinct adaptations in photosynthetic apparatus components, including cytochrome f, which can be quantified through biochemical assays. When presenting results, researchers should develop correlation matrices between specific amino acid substitutions and functional parameters to identify key residues involved in adaptive evolution.

What are the recommended approaches for investigating the role of Apocytochrome f in stress response mechanisms in Phaseolus vulgaris?

Investigating Apocytochrome f's role in stress response mechanisms requires integrated physiological, biochemical, and molecular approaches:

  • Stress Exposure Protocols:

    • Expose plants to controlled stress conditions (drought, salinity, temperature extremes)

    • Implement time-course sampling to capture dynamic responses

    • Include both sensitive and resistant genotypes for comparative analysis

  • Transcriptional Analysis:

    • Quantitative RT-PCR to measure petA expression changes under stress

    • RNA-seq for global transcriptional networks affecting cytochrome b6f complex

    • Promoter analysis to identify stress-responsive elements

  • Protein-Level Investigations:

    • Western blotting to quantify Apocytochrome f abundance

    • Post-translational modification analysis via mass spectrometry

    • Protein turnover studies using pulse-chase experiments

  • Functional Measurements:

    • Chlorophyll fluorescence to assess photosynthetic electron transport efficiency

    • P700 oxidation kinetics to evaluate electron flow through PSI

    • Reactive oxygen species (ROS) quantification to correlate with cytochrome b6f activity

The selection of appropriate Phaseolus vulgaris genotypes is critical, as some mutant lines demonstrate enhanced stress tolerance. For example, mutants M4, M19, and M26 derived from the Evros cultivar show improved drought tolerance compared to their parent line , making them valuable for comparative studies of Apocytochrome f function under stress. When designing experiments, researchers should consider both acute and chronic stress exposures, as they may elicit different regulatory mechanisms affecting the cytochrome b6f complex.

What techniques are most effective for studying the interaction between nuclear and chloroplast genomes in regulating petA expression and function?

Studying nuclear-chloroplast genome interactions in petA regulation requires sophisticated techniques addressing the unique challenges of organellar gene expression:

  • Transplastomic Approaches:

    • Chloroplast transformation to introduce reporter genes under petA regulatory elements

    • Creation of chimeric constructs to map nuclear factor binding sites

    • Site-directed mutagenesis of chloroplast regulatory sequences

  • Nuclear Factor Identification:

    • Yeast one-hybrid screens to identify nuclear proteins binding petA regulatory regions

    • Chromatin immunoprecipitation (ChIP) to validate in vivo interactions

    • Proteomics of isolated chloroplast nucleoids to identify DNA-binding proteins

  • Signal Integration Analysis:

    • Transcriptome analysis of both nuclear and chloroplast genes under varying conditions

    • Metabolite profiling to identify retrograde signaling molecules

    • Inhibitor studies targeting specific signaling pathways

  • Genetic Resources Utilization:

    • Creation of cybrid plants (combining nuclear genome from one accession with chloroplasts from another)

    • Analysis of hybrid incompatibility phenotypes, particularly between Middle American and Andean gene pools

    • CRISPR/Cas9 editing of nuclear factors for functional validation

When interpreting data, researchers must consider the divergent evolution of nuclear-chloroplast communication systems between the Middle American and Andean gene pools of Phaseolus vulgaris. The hybrid incompatibility observed in crosses between these pools provides a natural experimental system for studying these interactions . Advanced fluorescence in situ hybridization (FISH) techniques can provide visual evidence of nuclear-encoded factors colocalizing with chloroplast nucleoids, offering spatial context to biochemical interaction data .

How should researchers address variability in recombinant protein activity across different experimental batches?

Addressing variability in recombinant Phaseolus vulgaris Apocytochrome f activity across experimental batches requires systematic quality control and standardization:

  • Standard Reference Preparation:

    • Create a large reference batch with characterized activity

    • Use this as an internal standard across all experiments

    • Develop activity unit definitions based on standard assays

  • Critical Quality Attributes Monitoring:

    • Spectroscopic analysis of heme incorporation (A280/A420 ratio)

    • SDS-PAGE for consistent purity assessment (>90%)

    • Mass spectrometry to confirm intact protein mass and detect modifications

  • Statistical Control Approaches:

    • Implement acceptance criteria for batch-to-batch variation

    • Use statistical process control charts to monitor trends

    • Apply normalization factors based on reference standards

  • Documentation and Reporting:

    • Maintain detailed records of expression conditions

    • Document storage history (avoid repeated freeze-thaw cycles)

    • Report normalized activity values alongside absolute measurements

When analyzing experimental results, researchers should incorporate batch information as a random effect in statistical models, particularly in mixed-effects modeling approaches. Additionally, storage conditions significantly impact protein stability - maintaining aliquots at 4°C for no more than one week and avoiding repeated freeze-thaw cycles are critical practices . For long-term storage, adding glycerol to 50% final concentration before freezing at -20°C/-80°C helps preserve activity across experimental timeframes.

What statistical approaches are most appropriate for analyzing comparative studies of petA variants from different Phaseolus vulgaris genotypes?

When analyzing comparative studies of petA variants from different Phaseolus vulgaris genotypes, researchers should implement the following statistical approaches:

  • Experimental Design Considerations:

    • Blocked designs to account for environmental variation

    • Nested designs when comparing variants within gene pools

    • Power analysis to determine appropriate sample sizes

  • Appropriate Statistical Methods:

    • ANOVA or mixed models for continuous variables (activity, expression levels)

    • Principal Component Analysis for multivariate datasets

    • Hierarchical clustering to identify functional groupings of variants

  • Phylogenetic Comparative Methods:

    • Phylogenetic ANOVA to account for evolutionary relationships

    • Independent contrasts for correlation analyses

    • Ancestral state reconstruction to infer evolutionary trajectories

  • Addressing Common Challenges:

    • Non-normal distributions: Apply appropriate transformations or non-parametric tests

    • Heteroscedasticity: Use weighted analyses or robust statistical methods

    • Multiple testing: Apply Bonferroni or false discovery rate corrections

When interpreting results, researchers should consider the distinct genetic backgrounds of Middle American and Andean gene pools, which represent divergent evolutionary lineages with substantial genetic differentiation . Statistical analyses should incorporate this structure, potentially treating gene pool as a fixed effect in models. Additionally, when characterizing mutant lines, researchers should consider potential pleiotrophic effects, as mutations affecting petA expression may have broader impacts on photosynthetic apparatus assembly and function .

How can researchers differentiate between direct effects of petA mutations and secondary effects caused by disruption of protein-protein interactions?

Differentiating between direct effects of petA mutations and secondary consequences requires methodical experimental design and careful data interpretation:

  • Hierarchical Experimental Approach:

    • Begin with in vitro studies using purified components

    • Progress to reconstituted systems of increasing complexity

    • Culminate with in vivo validation in plant systems

  • Direct Effect Characterization:

    • Site-directed mutagenesis of specific residues

    • Biophysical characterization of isolated proteins (CD spectroscopy, thermal stability)

    • Direct activity assays with minimal components (electron transfer to defined acceptors)

  • Interaction Network Mapping:

    • Co-immunoprecipitation followed by mass spectrometry

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Blue native PAGE to assess complex assembly states

  • Genetic Complementation Strategies:

    • Complementation of petA mutants with variant constructs

    • Domain swapping experiments to isolate functional regions

    • Suppressor screens to identify compensatory mutations

  • Mathematical Modeling Approaches:

    • Kinetic modeling of electron transport chain

    • Network analysis of protein interactions

    • Simulation of mutation effects on energy landscapes

When analyzing results, researchers should create detailed interaction maps showing primary binding partners and secondary interaction networks. Mutations affecting residues directly involved in catalysis will typically show effects in minimal systems, while those disrupting protein-protein interactions often manifest only in more complex reconstitutions or in vivo systems. The genetic diversity observed between Middle American and Andean gene pools provides natural variation in interaction networks that can inform the interpretation of experimental mutations .

What are the prospects for using CRISPR/Cas9 genome editing to create novel Phaseolus vulgaris petA variants for functional studies?

The application of CRISPR/Cas9 genome editing to create novel Phaseolus vulgaris petA variants presents promising research opportunities:

  • Technical Implementation Strategies:

    • Chloroplast-targeted CRISPR/Cas9 systems for direct petA editing

    • Agrobacterium-mediated transformation protocols optimized for Phaseolus vulgaris

    • Protoplast-based screening systems for rapid assessment of editing efficiency

  • Target Selection Approaches:

    • Evolutionary conservation analysis to identify functionally critical residues

    • Structural modeling to predict residues involved in protein-protein interactions

    • Comparison of natural variants between gene pools to identify adaptive mutations

  • Validation Methodologies:

    • Molecular confirmation of edits via sequencing

    • Protein level verification through immunoblotting and mass spectrometry

    • Physiological characterization focusing on photosynthetic efficiency parameters

  • Research Applications:

    • Creation of electron transfer variants with altered kinetic properties

    • Engineering stress-responsive regulatory elements

    • Development of tagged versions for in vivo visualization

When designing CRISPR experiments, researchers should consider the distinct genetic backgrounds of Middle American and Andean gene pools, as editing efficiency and phenotypic outcomes may vary between these backgrounds . Additionally, the integration of cytomolecular approaches such as fluorescence in situ hybridization can provide valuable information about how edited variants affect genome stability and organization .

How can systems biology approaches integrate transcriptomic, proteomic, and metabolomic data to understand the role of Apocytochrome f in photosynthetic adaptation?

Systems biology offers powerful frameworks for integrating multi-omics data to understand Apocytochrome f's role in photosynthetic adaptation:

  • Multi-Omics Data Collection:

    • Coordinated sampling across developmental stages and conditions

    • Simultaneous extraction protocols for RNA, protein, and metabolites

    • Implementation of internal standards for cross-experiment normalization

  • Integration Methodologies:

    • Gene-protein-metabolite correlation networks

    • Pathway enrichment analysis incorporating all data types

    • Machine learning approaches for pattern identification across datasets

  • Mathematical Modeling Approaches:

    • Flux balance analysis of photosynthetic metabolism

    • Kinetic modeling of electron transport chain

    • Agent-based modeling of thylakoid membrane dynamics

  • Visualization and Analysis Tools:

    • Multi-layer network visualization software

    • Time-series analysis with lagged correlations

    • Causal inference algorithms to establish regulatory relationships

When implementing systems biology approaches, researchers should compare data from diverse Phaseolus vulgaris genotypes, particularly contrasting Middle American and Andean gene pools which represent distinct evolutionary trajectories with different adaptive strategies . Additionally, incorporation of cytomolecular data from FISH and flow cytometry analyses can provide valuable chromosomal context to gene expression patterns . The integration of stress response data is particularly valuable, as some mutant lines (M4, M19, M26) demonstrate enhanced drought tolerance and disease resistance that may involve altered regulation of photosynthetic components .

What role might Apocytochrome f modifications play in enhancing photosynthetic efficiency in Phaseolus vulgaris under changing climate conditions?

Investigating Apocytochrome f modifications for enhanced photosynthetic efficiency under climate change requires forward-looking research approaches:

  • Climate Scenario Testing:

    • Controlled environment studies simulating predicted climate parameters

    • Field trials in gradient environments representing future conditions

    • Long-term selection experiments under elevated CO2 and temperature

  • Targeted Modification Strategies:

    • Screening natural variation in petA sequences from diverse habitats

    • Engineering modifications at temperature-sensitive domains

    • Creating variants with altered regulation responsive to environmental cues

  • Performance Assessment Methodology:

    • Gas exchange combined with chlorophyll fluorescence

    • Carbon isotope discrimination for water-use efficiency

    • Growth and yield measurements under fluctuating conditions

  • Integration with Adaptation Biology:

    • Correlation of natural petA variants with habitat parameters

    • Identification of convergent adaptations across species

    • Study of epistatic interactions with other photosynthetic components

The genetic diversity within Phaseolus vulgaris provides valuable resources for this research, particularly the contrasting adaptations between Middle American and Andean gene pools that evolved under different environmental pressures . Cytomolecular approaches can track genomic changes during adaptation, while experimental evolution experiments can reveal real-time adaptive changes under simulated climate conditions . When evaluating engineered variants, researchers should assess not only photosynthetic efficiency but also pleiotropic effects on plant development, stress tolerance, and reproductive success to ensure holistic improvement of climate resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.