Recombinant Phaseolus vulgaris ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phaseolus vulgaris ATP Synthase Subunit a, Chloroplastic (atpI)

Recombinant Phaseolus vulgaris ATP synthase subunit a, chloroplastic (atpI), is a genetically engineered version of the subunit a protein found in the chloroplasts of the common bean, Phaseolus vulgaris. This protein is part of the chloroplast ATP synthase complex, which plays a crucial role in photosynthesis by converting light energy into chemical energy in the form of ATP (adenosine triphosphate). The recombinant form allows for the production of this protein in large quantities using bacterial expression systems, such as Escherichia coli, facilitating detailed biochemical and structural studies.

Function of ATP Synthase Subunit a

ATP synthase is a rotary molecular machine that uses the proton gradient across the thylakoid membrane to drive ATP synthesis. The subunit a is part of the F₀ domain, which spans the membrane and is involved in proton translocation. This process is essential for generating the torque needed to rotate the stalk that drives ATP synthesis in the F₁ domain .

Recombinant Production

Recombinant production of the subunit a involves expressing the gene encoding this protein in a suitable host organism, typically Escherichia coli. The gene is often fused with a tag, such as a His-tag, to facilitate purification. The recombinant protein is then expressed, purified, and characterized to ensure its structural and functional integrity .

Research Findings and Applications

Research on recombinant ATP synthase subunits, including subunit a, has provided insights into the structure-function relationships of these enzymes. Studies have shown that modifications in specific residues can affect proton translocation efficiency and ATP synthesis rates . These findings have implications for understanding how plants optimize energy production during photosynthesis.

Table 1: Key Features of Recombinant Phaseolus vulgaris ATP Synthase Subunit a

FeatureDescription
Expression SystemTypically Escherichia coli
TagOften His-tagged for purification
FunctionInvolved in proton translocation across thylakoid membrane
ImportanceEssential for ATP synthesis during photosynthesis

Table 2: Comparison of ATP Synthase Subunit a Across Different Organisms

OrganismSubunit a Features
Phaseolus vulgarisChloroplastic, involved in photosynthesis
Acorus americanusChloroplastic, similar function to Phaseolus vulgaris
Bacillus pseudofirmusAlkaliphilic, distinct proton uptake pathway

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Phaseolus vulgaris (Kidney bean) (French bean)
Target Names
atpI
Target Protein Sequence
MNVLLCSINTLKRLYDISAVEVGQHFYWQIGGFLVHAQVLITSWVVIAILLVSAFLVIRN LQTIPAFGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALFPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLAYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESIEGHH
Uniprot No.

Target Background

Function
This protein plays a crucial role as a key component of the proton channel, directly involved in the translocation of protons across the membrane.
Database Links

KEGG: pvu:PhvuCp26

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological role of ATP synthase subunit a (atpI) in Phaseolus vulgaris chloroplasts?

ATP synthase subunit a in P. vulgaris chloroplasts plays a critical role in the F0 portion of the ATP synthase complex, which is embedded in the thylakoid membrane. This subunit forms part of the proton channel, directing protons from the lumen through the membrane to drive rotation of the c-ring. This mechanical rotation is coupled to the F1 domain where ATP synthesis occurs. The a-subunit works in conjunction with the c-ring to facilitate proton translocation across the membrane, utilizing the proton gradient established during photosynthesis to generate the energy required for ATP production .

How does chloroplastic ATP synthase structure in P. vulgaris compare to other plant species?

While P. vulgaris-specific structural data is limited, chloroplastic ATP synthase maintains a highly conserved structure across plant species. Like other plants, P. vulgaris ATP synthase consists of two main functional domains: F1 (situated in the chloroplast stroma) and F0 (embedded in the thylakoid membrane). The F1 region typically includes subunits α3, β3, γ, δ, and ε, while the F0 region contains subunits a, b, b', and cn. The architecture allows for the mechanical coupling of proton translocation with ATP synthesis through a rotational mechanism. Based on comparisons with well-studied species like spinach (Spinacia oleracea), we can infer that P. vulgaris likely maintains similar structural features while potentially exhibiting species-specific variations in certain subunits .

What genomic and proteomic approaches are used to characterize the atpI gene and protein in Phaseolus vulgaris?

Characterization of the atpI gene and protein in P. vulgaris typically employs a multi-omics approach. Genomic characterization begins with PCR amplification of the atpI gene from chloroplast DNA, followed by sequencing to determine the exact nucleotide sequence. For transcriptome analysis, RNA-seq and quantitative PCR provide insights into expression patterns under various conditions. At the protein level, researchers employ techniques such as mass spectrometry, Western blotting with specific antibodies, and N-terminal sequencing to confirm protein identity. Structural analysis may include circular dichroism to determine secondary structure elements (similar to the alpha-helical confirmation of c-subunits) . These techniques collectively provide a comprehensive characterization of both the gene and resulting protein product.

How can researchers optimize recombinant expression systems for P. vulgaris atpI to overcome hydrophobicity challenges?

Optimizing recombinant expression of the highly hydrophobic P. vulgaris atpI requires strategic approaches similar to those employed for other membrane proteins. A multi-faceted strategy includes:

  • Expression system selection: While E. coli is commonly used (as with the c-subunit from spinach) , consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Fusion tag incorporation: Employ solubility-enhancing fusion partners such as maltose-binding protein (MBP, successfully used with c-subunit) , SUMO, or thioredoxin to improve folding and reduce aggregation.

  • Expression conditions optimization:

    • Reduce expression temperature (16-20°C)

    • Use lower IPTG concentrations (0.1-0.5 mM)

    • Supplement media with specific membrane-promoting compounds

  • Detergent screening matrix:

Detergent ClassExamplesOptimal ConcentrationApplication Stage
Non-ionicDDM, LDAO1-2%Solubilization
ZwitterionicCHAPS, Fos-Choline0.5-1%Purification
Mild non-ionicOG, DM0.05-0.1%Crystallization

This comprehensive approach addresses the challenges of expressing hydrophobic membrane proteins while maintaining native-like structure and function .

What are the critical factors affecting the assembly of recombinant atpI into functional ATP synthase complexes?

The assembly of recombinant atpI into functional ATP synthase complexes involves several critical factors that must be carefully controlled:

  • Stoichiometric balance: The correct ratio of subunits is essential for proper assembly. Research on other ATP synthase components suggests that translational regulation between nuclear-encoded and chloroplast-encoded subunits is critical for balanced production .

  • Assembly sequence: Evidence from ATP synthase assembly studies indicates a specific order of component integration. For chloroplastic ATP synthase, c-ring formation likely precedes the binding of F1, followed by the stator arm, and finally subunits a and A6L .

  • Chaperone assistance: Specialized chaperones facilitate proper folding and prevent aggregation during assembly. While specific chaperones for P. vulgaris atpI haven't been characterized, homologs of assembly factors identified in other species (like ATP10p in yeast) may play similar roles .

  • Membrane environment: The lipid composition and physical properties of the membrane significantly impact the insertion and folding of atpI. Reconstitution experiments should mimic the native thylakoid membrane environment .

  • Post-translational modifications: Any species-specific modifications necessary for proper function must be preserved or replicated in the recombinant system.

Monitoring these factors through techniques such as blue native PAGE, fluorescence resonance energy transfer (FRET), or analytical ultracentrifugation can provide insights into assembly efficiency and identify potential bottlenecks .

What expression vector systems are most effective for recombinant production of P. vulgaris atpI?

The selection of an appropriate expression vector system is crucial for successful recombinant production of P. vulgaris atpI. Based on successful approaches with other ATP synthase components, the following systems show promise:

  • pMAL vector system: This system, which creates fusions with maltose-binding protein (MBP), has proven effective for the recombinant expression of hydrophobic ATP synthase subunits like the c-subunit from spinach . The MBP tag enhances solubility while allowing for simple affinity purification.

  • pET vector series: These vectors offer strong, inducible expression under the T7 promoter and are widely used for membrane proteins. Specifically, pET28a(+) provides a His-tag for purification and has been successfully employed for ATP synthase subunit expression .

  • Dual-plasmid systems: For complex assembly studies, dual-plasmid systems allow co-expression of multiple subunits with controlled stoichiometry, potentially facilitating proper complex formation.

The optimal vector should include:

  • Inducible promoter with tight regulation

  • Appropriate fusion tags (MBP, SUMO, or His-tag)

  • Compatible antibiotic resistance markers

  • Protease cleavage sites for tag removal

  • Signal sequences if membrane targeting is desired

The choice between these systems depends on specific experimental goals, with the pMAL system being particularly promising due to its documented success with similar membrane proteins from chloroplasts .

What purification strategies yield the highest purity and activity of recombinant atpI?

Purifying recombinant atpI to high levels of purity while maintaining activity requires a carefully designed multi-step strategy:

  • Initial extraction and solubilization:

    • Gentle cell lysis (osmotic shock or enzymatic methods preferred over sonication)

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using mild detergents (DDM 1-2% or LDAO 1%)

  • Affinity chromatography:

    • For MBP-fusion proteins: Amylose resin chromatography, similar to successful methods used for c-subunit purification

    • For His-tagged proteins: Immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins

    • Optimization of salt concentration and pH to minimize non-specific binding

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography to remove contaminants with different charge profiles

  • Tag removal and final polishing:

    • Specific protease treatment (TEV, Factor Xa) for tag removal

    • Reverse IMAC to separate cleaved protein from tag

    • Final size exclusion step in appropriate detergent/lipid mixtures

A typical purification table showing expected results:

Purification StepProtein Recovery (%)Purity (%)Specific Activity (units/mg)
Crude extract1005-1010-20
Membrane fraction60-7020-3030-50
Affinity chromatography40-5070-80100-150
Size exclusion30-4085-90200-250
Tag removal20-3090-95250-300
Final polishing15-20>95300-350

Throughout the process, detergent concentration should be maintained just above the critical micelle concentration to prevent protein aggregation while avoiding excess detergent .

How can researchers verify the proper folding and functionality of recombinant atpI?

Verifying proper folding and functionality of recombinant atpI requires multiple complementary approaches:

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to confirm alpha-helical content, as successfully applied to ATP synthase c-subunit

    • Fourier-transform infrared spectroscopy (FTIR) to assess secondary structure elements in membrane environments

  • Tertiary structure assessment:

    • Limited proteolysis patterns compared to native protein

    • Intrinsic fluorescence spectroscopy to monitor tryptophan/tyrosine environments

    • Thermal shift assays to evaluate protein stability

  • Functional assays:

    • Reconstitution into liposomes or nanodiscs for proton translocation assays

    • Assembly with other ATP synthase components to form partial or complete complexes

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Interaction studies:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Surface plasmon resonance to measure binding affinities

    • Cross-linking experiments to identify interaction partners

  • Structural imaging:

    • Negative stain electron microscopy to visualize reconstituted complexes

    • Atomic force microscopy for topological assessment in membrane environments

These complementary approaches provide a comprehensive assessment of whether the recombinant atpI maintains native-like structure and function. Particular emphasis should be placed on alpha-helical content (expected to be high for this membrane protein) and the ability to interact with other ATP synthase subunits, especially the c-ring with which it forms the critical proton translocation machinery .

What spectroscopic techniques are most informative for analyzing the structure of recombinant atpI?

Several spectroscopic techniques provide valuable structural information about recombinant atpI, each offering distinct insights:

  • Circular Dichroism (CD) Spectroscopy: Far-UV CD (190-250 nm) reveals secondary structure composition, particularly useful for quantifying the alpha-helical content expected in atpI. Near-UV CD (250-350 nm) provides information about tertiary structure through aromatic amino acid signals. This technique has been successfully applied to ATP synthase subunits, confirming the alpha-helical structure of the c-subunit .

  • Fourier Transform Infrared (FTIR) Spectroscopy: Particularly valuable for membrane proteins, FTIR can analyze secondary structure in native-like lipid environments through characteristic amide I and II bands (1700-1500 cm⁻¹).

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For specific structural details, ¹H-¹⁵N HSQC experiments can provide residue-specific information about protein folding. Solid-state NMR is particularly applicable to membrane proteins like atpI.

  • Raman Spectroscopy: Provides complementary information to FTIR without interference from water, allowing analysis in aqueous environments.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: When combined with site-directed spin labeling, EPR can measure distances between specific residues and monitor conformational changes during function.

A systematic approach combining multiple techniques offers the most comprehensive structural characterization:

TechniqueInformation ProvidedSample RequirementsAdvantages
CDSecondary structure, protein folding0.1-1 mg/ml, detergent-solubilizedQuick, non-destructive
FTIRSecondary structure in lipids1-2 mg, reconstitutedNative-like environment
NMRAtomic-level structure5-10 mg, isotope-labeledHighest resolution
RamanSecondary structure2-5 mg/mlCompatible with aqueous samples
EPRDistance measurementsSpin-labeled mutantsDynamic information

These spectroscopic approaches should be combined with computational modeling based on homology to related ATP synthase subunits for a complete structural understanding .

How does the proton translocation mechanism in P. vulgaris atpI compare with other plant species?

The proton translocation mechanism in P. vulgaris atpI likely follows fundamental principles observed across plant species, but may exhibit unique species-specific adaptations:

  • Core translocation mechanism: As in other plants, P. vulgaris atpI likely forms half-channels with the c-ring interface that allow protons to access the critical glutamate residue on each c-subunit. The a-subunit provides distinct input and output half-channels, directing protons from the lumen to the c-ring and then to the stroma . The proton binding to the glutamate residue drives the rotation of the c-ring, which is mechanically coupled to ATP synthesis in the F1 domain.

  • Species-specific adaptations: While the fundamental mechanism is conserved, P. vulgaris may display adaptations in:

    • The number of c-subunits in the ring, which determines the H⁺/ATP ratio

    • The exact amino acid composition of the proton channel

    • Regulatory mechanisms that respond to environmental conditions specific to common bean physiology

  • Comparative analysis: Studies from spinach chloroplast ATP synthase provide the closest reference point, showing that chloroplastic ATP synthases typically have larger c-rings (14 subunits) compared to mitochondrial counterparts (8-10 subunits) . This structural difference affects the bioenergetic efficiency - larger rings translocate more protons per ATP synthesized.

  • Key residues: Conserved arginine residues in subunit a likely play a critical role in preventing proton leakage between half-channels, while conserved glutamate residues in the c-subunits serve as the proton binding sites. Sequence analysis between P. vulgaris and other species can identify these conservation patterns and any unique variations .

The detailed comparison requires structural and functional studies specific to P. vulgaris, combined with comparative genomics and proteomic analyses across multiple plant species .

What approaches can be used to study the interaction between atpI and other ATP synthase subunits?

Investigating the interactions between atpI and other ATP synthase subunits requires a multi-faceted approach combining biochemical, biophysical, and imaging techniques:

  • Co-immunoprecipitation (Co-IP) and pull-down assays: Using antibodies against atpI or other subunits to isolate interacting partners. Tags like MBP or His can facilitate pull-down experiments with recombinant proteins .

  • Cross-linking coupled with mass spectrometry (XL-MS): Chemical cross-linkers of various lengths can capture transient interactions, followed by mass spectrometry to identify cross-linked peptides, providing spatial constraints for protein-protein interfaces.

  • Surface Plasmon Resonance (SPR) and Microscale Thermophoresis (MST): These techniques quantify binding affinities and kinetics between atpI and other subunits, particularly important for interactions with the c-ring and peripheral stalk components.

  • Förster Resonance Energy Transfer (FRET): By labeling atpI and potential partner subunits with appropriate fluorophore pairs, researchers can detect proximity and conformational changes during complex assembly and function.

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact protein complexes and can identify subcomplexes and assembly intermediates, revealing the integration of atpI into the larger ATP synthase complex .

  • Electron microscopy (EM) and single-particle analysis: Negative stain EM or cryo-EM can visualize the structural arrangement of reconstituted complexes containing atpI and interacting partners.

  • In silico molecular docking and molecular dynamics simulations: Computational approaches can predict interaction interfaces and dynamic behavior based on available structural information.

A systematic experimental design might include:

MethodInformation ObtainedAdvantagesLimitations
Co-IP/pull-downIdentification of binding partnersSimple, robustQualitative
XL-MSSpecific interaction sitesSpatial constraintsRequires optimization
SPR/MSTBinding kinetics and affinitiesQuantitativeRequires purified components
FRETDynamic interactionsReal-time analysisComplex labeling
BN-PAGEComplex assemblyNative conditionsLimited resolution
EMStructural arrangementVisual confirmationSample preparation challenges
In silicoInteraction predictionNo wet-lab requiredRequires validation

These complementary approaches provide a comprehensive understanding of how atpI integrates into the ATP synthase complex and contributes to its function .

What are the most common challenges in recombinant atpI expression and how can they be addressed?

Recombinant expression of atpI presents several common challenges that researchers frequently encounter. The following table outlines these challenges and provides evidence-based solutions:

ChallengeManifestationSolution StrategiesValidation Methods
Protein toxicityPoor growth, plasmid instabilityUse tightly regulated promoters (pBAD), C41/C43(DE3) strains, lower temperature (16-20°C)Growth curves, plasmid stability assays
Inclusion body formationInsoluble protein fractionMBP fusion tags , lower IPTG concentration (0.1-0.2 mM), co-expression with chaperonesSDS-PAGE of soluble/insoluble fractions
Poor membrane integrationLow recovery from membrane fractionOptimize signal sequences, use specialized membrane protein expression strainsMembrane fraction analysis, fluorescence microscopy
Incorrect foldingLoss of function, aggregationDetergent screening, lipid supplementation, incremental temperature rampingCD spectroscopy for secondary structure
Low yieldInsufficient protein for experimentsCodon optimization, high cell-density fermentation, fusion partner optimizationQuantitative Western blot
Proteolytic degradationMultiple bands, loss of full-length proteinProtease-deficient strains, optimal extraction buffers with protease inhibitorsTime-course stability analysis

A stepwise optimization approach is recommended, addressing each challenge systematically. For example, researchers working with ATP synthase c-subunit from spinach found that expressing the protein as an MBP fusion significantly improved solubility and proper folding . Similar strategies are likely applicable to P. vulgaris atpI.

How can researchers overcome challenges in reconstituting atpI into functional ATP synthase complexes?

Reconstituting atpI into functional ATP synthase complexes presents significant challenges due to the complexity of multi-subunit assembly. A systematic approach to overcome these challenges includes:

  • Stepwise assembly strategy:

    • Begin with binary interactions (atpI + c-ring) before attempting complete complex assembly

    • Follow the natural assembly pathway identified in other systems: c-ring formation, followed by F1 attachment, stator assembly, and finally incorporation of subunits a and A6L

    • Use partially assembled subcomplexes as scaffolds for subsequent integration steps

  • Membrane environment optimization:

    • Screen multiple lipid compositions to mimic the native thylakoid membrane

    • Test various lipid-to-protein ratios (typical range: 50:1 to 200:1 w/w)

    • Explore nanodiscs or liposomes of different sizes (50-200 nm) for optimal reconstitution

  • Stabilization strategies:

    • Introduce specific cross-links to stabilize critical interfaces

    • Co-express partner subunits to promote co-folding and assembly

    • Screen buffer conditions (pH, ionic strength, specific ions) for complex stability

  • Activity verification methods:

    • Monitor proton translocation using pH-sensitive fluorescent dyes

    • Assess ATP synthesis/hydrolysis coupling using luciferin/luciferase assays

    • Visualize complex formation using negative stain electron microscopy

Research on yeast ATP synthase has shown that assembly involves distinct modules (c-ring, F1, and a/A6L/stator subunits) that converge in late-stage assembly . This modular approach can be adapted for reconstitution of P. vulgaris ATP synthase containing recombinant atpI.

What analytical techniques are most effective for troubleshooting and quality control of recombinant atpI preparations?

Effective troubleshooting and quality control of recombinant atpI preparations require a comprehensive analytical toolkit:

  • Purity assessment:

    • SDS-PAGE with silver staining (detection limit ~1 ng protein)

    • Reversed-phase HPLC for detection of protein variants and degradation products

    • Mass spectrometry for accurate mass determination and identification of post-translational modifications

  • Structural integrity analysis:

    • Circular dichroism spectroscopy to verify alpha-helical content

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to assess oligomeric state and homogeneity

    • Dynamic light scattering (DLS) to detect aggregation and determine particle size distribution

  • Functional verification:

    • Reconstitution assays in proteoliposomes to measure proton translocation

    • Binding assays with partner subunits (particularly c-ring components)

    • ATPase activity assays when incorporated into larger complexes

  • Stability monitoring:

    • Differential scanning calorimetry (DSC) to determine thermal stability

    • Time-course stability studies at different temperatures and in various buffer conditions

    • Protease resistance assays to evaluate structural compactness

A systematic quality control workflow might include:

StageAnalytical TechniqueAcceptance CriteriaTroubleshooting Action
Post-expressionWestern blotSingle band at expected MWOptimize expression conditions
Post-purificationSDS-PAGE>90% purityAdditional purification steps
StructuralCD spectroscopyAlpha-helical signature Adjust detergent/buffer conditions
HomogeneitySEC-MALSMonodisperse peakOptimize stabilization conditions
FunctionalityProton translocationActivity >70% of nativeRefine reconstitution protocol
StabilityThermal shift assayTm within 5°C of nativeBuffer optimization

These analytical approaches provide complementary information about the quality and functionality of recombinant atpI preparations, enabling systematic troubleshooting and optimization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.