Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify this in your order for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Phaseolus vulgaris (Kidney bean) (French bean)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSLIPILAFLISGILAPISKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALIFVVFDVETVFLYPWAMSFDVLGVSVFLEAFLFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Database Links

KEGG: pvu:PhvuCp09

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase in chloroplasts functions as part of the photosynthetic electron transport chain, catalyzing the reduction of quinones using NAD(P)H as an electron donor. This enzyme plays a crucial role in cyclic electron flow around photosystem I, contributing to ATP synthesis without NADPH production. Furthermore, recent evidence indicates that these enzymes may also function as superoxide scavengers, protecting the photosynthetic apparatus from oxidative damage during high light conditions or other stress situations . In experimental systems with bean leaves, these enzymes show adaptive responses to light-dark cycles, with activity patterns changing during development .

How does the structure of subunit 3 differ from other subunits like 4L in the NAD(P)H-quinone oxidoreductase complex?

Subunit 3 of NAD(P)H-quinone oxidoreductase differs from other subunits such as 4L in terms of size, amino acid sequence, and specific functional contributions to the enzyme complex. While subunit 4L is 101 amino acids in length (based on the sequence data available), subunit 3 has a different molecular weight and structural organization . These structural differences reflect their specialized roles within the multi-subunit enzyme complex, with each subunit contributing to substrate binding, electron transfer, or complex stability. The predicted molecular weight of subunit 2 (NdhB), a related subunit, is approximately 35 kDa, which provides a reference point for understanding the size range of these protein components .

What are the optimal expression systems for producing recombinant Phaseolus vulgaris NAD(P)H-quinone oxidoreductase subunit 3?

The optimal expression system for recombinant production of Phaseolus vulgaris NAD(P)H-quinone oxidoreductase subunit 3 is typically an E. coli-based in vitro expression system, which allows for high yield and relatively straightforward purification. Based on related protocols for similar proteins, the approach typically involves:

  • Gene cloning into an appropriate expression vector with an N-terminal histidine tag for purification

  • Transformation into a compatible E. coli strain (commonly BL21(DE3) or derivatives)

  • Induction of protein expression using IPTG at concentrations of 0.1-1.0 mM

  • Cell harvesting and lysis under conditions that preserve protein activity

  • Purification using nickel affinity chromatography

For optimal expression, cultivation temperature is typically lowered to 16-25°C after induction to enhance proper folding of the recombinant protein . The inclusion of molecular chaperones as co-expression partners can sometimes improve the yield of properly folded protein.

What purification strategies yield the highest purity and activity for recombinant NAD(P)H-quinone oxidoreductase?

A successful purification strategy for recombinant NAD(P)H-quinone oxidoreductase that maximizes both purity and enzymatic activity typically involves:

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal histidine tag as the primary capture step

  • Buffer optimization containing stabilizing agents (often 6% trehalose in Tris/PBS-based buffer, pH 8.0)

  • Size exclusion chromatography as a polishing step to remove aggregates and improve homogeneity

  • Activity assays at each purification stage to monitor preservation of enzymatic function

The purified protein should be stored at -20°C/-80°C with appropriate cryoprotectants to maintain stability. For maximum retention of activity, the protein can be lyophilized, which extends shelf life to approximately 12 months at -20°C/-80°C compared to 6 months for liquid formulations . Aliquoting is necessary to avoid repeated freeze-thaw cycles that can substantially decrease enzymatic activity.

How can researchers accurately measure the superoxide scavenging activity of recombinant NAD(P)H-quinone oxidoreductase?

Accurate measurement of superoxide scavenging activity for recombinant NAD(P)H-quinone oxidoreductase can be accomplished through several complementary methodologies:

  • Oxygen consumption assay: Monitor the stoichiometry of oxygen consumption to NAD(P)H oxidation (ideally 1:1) using an oxygen electrode, while simultaneously measuring hydrogen peroxide production as a product .

  • Superoxide-dependent auto-oxidation: Assess the acceleration of enzyme auto-oxidation in the presence of superoxide versus its inhibition when superoxide dismutase is added. This provides insight into the kinetics of superoxide interactions with the enzyme .

  • Spectrophotometric methods: Measure inhibition of dihydroethidium oxidation or pyrogallol auto-oxidation in the presence of the enzyme with NAD(P)H .

  • Electron spin resonance (ESR): Evaluate the elimination of superoxide-adduct signals when the enzyme is present with NAD(P)H .

For kinetic parameter determination, researchers can employ the xanthine/xanthine oxidase system as a controlled source of superoxide, allowing for estimation of reaction rates and binding affinities . When analyzing data, it's critical to distinguish between direct superoxide scavenging and indirect effects through other reactive oxygen species.

What approaches can resolve structural conformational changes during electron transfer in NAD(P)H-quinone oxidoreductase?

Resolving structural conformational changes during electron transfer in NAD(P)H-quinone oxidoreductase requires sophisticated biophysical techniques:

  • Time-resolved X-ray crystallography: This approach can capture transient intermediates during the catalytic cycle, though it requires successful crystallization of the protein.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies regions of the protein that undergo conformational changes during catalysis by measuring the rate of hydrogen exchange in different functional states.

  • FRET (Förster Resonance Energy Transfer): By incorporating fluorescent labels at strategic positions, researchers can monitor distance changes between protein domains during electron transfer.

  • EPR (Electron Paramagnetic Resonance) spectroscopy: This method can track changes in the environment of paramagnetic centers during catalysis, providing insights into electron movement through the protein.

  • Molecular dynamics simulations: Computational approaches can model conformational changes based on experimental structures, helping to interpret experimental data.

These methods can be particularly valuable when studying the differences in electron transfer mechanisms between different subunits of the complex, such as subunit 3 versus subunit 4L .

How does light-dark cycling affect NAD(P)H-quinone oxidoreductase activity in bean leaves?

Light-dark cycling significantly impacts NAD(P)H-quinone oxidoreductase activity in bean leaves through several adaptive mechanisms:

  • Structural reorganization: Prolamellar bodies develop during night periods and disappear during light periods, reflecting ultrastructural adaptation to changing light conditions .

  • Activity ratio changes: The ratio of photoactive to non-photoactive protochlorophyllide (Pchlide) is higher at the end of light periods and increases with the number of light-dark cycles, indicating dynamic regulation of the enzyme system .

  • Spectral shifts: Flash-induced absorbance changes in the chlorophyllide (Chlide) absorption region (700 nm) reveal changes in the formation of short- and long-wavelength forms of Chlide (C670-675 and C682-694) .

  • Regeneration kinetics: During light periods, photoactive Pchlide regeneration and Chlide phytylation complete within 1 minute after flash-induced formation of long-wavelength Chlide, demonstrating rapid photoenzymatic cycling .

When designing experiments to study these effects, researchers should carefully control the light-dark cycle timing and intensity, and consider collecting samples at both end-of-light and end-of-dark periods to capture the full range of enzymatic adaptations. The photoenzymatic LPOR cycle proceeds through similar steps in photoperiodic greening as in etiolated plants but at much faster rates .

What are the experimental challenges in distinguishing between the functions of different subunits in the NAD(P)H-quinone oxidoreductase complex?

Distinguishing between the functions of different subunits (such as subunit 3 and subunit 4L) in the NAD(P)H-quinone oxidoreductase complex presents several experimental challenges:

Researchers can address these challenges through:

  • Systematic mutagenesis of specific residues rather than entire subunits

  • Complementation studies in knockout systems

  • Use of subunit-specific tagged recombinant proteins to track localization and interactions

  • Comparative proteomics across different plant species where the complex composition may vary

  • Highly specific antibodies for western blot analysis, with careful validation of specificity across related plant species

How does Phaseolus vulgaris NAD(P)H-quinone oxidoreductase compare to homologs in other plant species?

Phaseolus vulgaris NAD(P)H-quinone oxidoreductase shows both conserved and divergent features when compared to homologs in other plant species:

FeaturePhaseolus vulgarisArabidopsis thalianaZea maysOther Species
Subunit compositionIncludes subunit 3 and 4LSimilar structureSimilar structureConserved across most flowering plants
Molecular weightVariable by subunitNdhB: ~35 kDaNdhB: ~35 kDaGenerally conserved
Antibody cross-reactivityVariableStrong for NdhBStrong for NdhBPredicted in multiple related species
Cellular localizationChloroplasticChloroplasticChloroplasticConsistently chloroplastic
Species-specific adaptationsBean-specific featuresModel plant systemC4 photosynthesis adaptationsVaries with photosynthetic strategy

What post-translational modifications regulate NAD(P)H-quinone oxidoreductase activity in chloroplasts?

Post-translational modifications (PTMs) play crucial roles in regulating NAD(P)H-quinone oxidoreductase activity in chloroplasts, though specific data for the Phaseolus vulgaris enzyme is limited. Based on studies of related enzymes:

  • Phosphorylation: Key serine and threonine residues can be phosphorylated in response to redox state changes or light conditions, modulating enzymatic activity and protein-protein interactions.

  • Redox-sensitive modifications: Cysteine residues may undergo reversible oxidation, forming disulfide bridges that alter enzyme conformation and activity in response to changing redox environments within the chloroplast.

  • N-terminal processing: The mature chloroplastic protein undergoes N-terminal processing after import into the chloroplast, as suggested by the expression of recombinant proteins with N-terminal tags .

  • Complex assembly-dependent activation: Individual subunits may remain inactive until properly incorporated into the multi-subunit complex, representing a form of regulation through protein-protein interactions.

When studying these modifications, researchers should consider techniques such as mass spectrometry-based proteomics, which can identify specific modified residues, and site-directed mutagenesis to evaluate the functional significance of these modifications.

What are common issues in maintaining recombinant NAD(P)H-quinone oxidoreductase stability during storage and experimentation?

Researchers frequently encounter stability challenges when working with recombinant NAD(P)H-quinone oxidoreductase. Common issues and solutions include:

  • Aggregation and precipitation: The hydrophobic regions of membrane-associated proteins like NAD(P)H-quinone oxidoreductase can promote aggregation. To mitigate this:

    • Store in buffer containing 6% trehalose as a stabilizing agent

    • Maintain pH at approximately 8.0 using Tris/PBS-based buffers

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

  • Activity loss during storage: Enzymatic activity can diminish over time, with liquid formulations typically maintaining stability for about 6 months at -20°C/-80°C, while lyophilized preparations extend shelf life to approximately 12 months .

  • Oxidative damage: As the enzyme interacts with oxygen, it can undergo auto-oxidation, particularly in the presence of superoxide. Including reducing agents in buffers and working under nitrogen atmosphere when possible can help maintain activity .

  • Thermal sensitivity: Protein denaturation can occur at room temperature. Always thaw samples on ice immediately before use and spin tubes briefly before opening to collect material that may adhere to caps or sides .

  • Buffer incompatibility: Some buffer components may interfere with activity assays. Control experiments with buffer-only samples are essential to identify potential interference.

How can researchers optimize heterologous expression to improve yield and functionality of NAD(P)H-quinone oxidoreductase subunits?

Optimizing heterologous expression of NAD(P)H-quinone oxidoreductase subunits requires addressing several key factors:

  • Codon optimization: Adjusting the coding sequence to match codon usage preferences of the expression host can significantly improve translation efficiency and protein yield.

  • Expression temperature modulation: Lowering the cultivation temperature after induction (typically to 16-20°C) often improves proper folding of complex proteins.

  • Induction strategies: Testing various IPTG concentrations (0.1-1.0 mM) and induction timing can identify conditions that balance expression level with proper folding.

  • Co-expression with chaperones: Including molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE, or trigger factor can enhance proper folding of challenging proteins.

  • Solubility tags: Beyond the N-terminal histidine tag used for purification, adding solubility-enhancing tags such as SUMO, MBP, or thioredoxin can improve yield of soluble protein.

  • Expression host selection: While E. coli is commonly used, specific strains like Rosetta (for rare codons) or SHuffle (for disulfide bond formation) may improve expression of particular proteins .

  • Media composition: Enriched media formulations and supplementation with cofactors relevant to the target protein can improve yield and activity.

Researchers should systematically optimize these parameters, using small-scale expression tests before scaling up to production volumes.

What emerging techniques could advance understanding of NAD(P)H-quinone oxidoreductase structure-function relationships?

Several cutting-edge techniques show promise for deepening our understanding of NAD(P)H-quinone oxidoreductase structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): This technique can resolve high-resolution structures of membrane protein complexes without the need for crystallization, potentially revealing the native organization of the entire NAD(P)H-quinone oxidoreductase complex.

  • Single-molecule FRET: By observing individual enzyme molecules during catalysis, researchers can capture transient conformational states and kinetic heterogeneity that might be missed in ensemble measurements.

  • Nanodiscs and native-like membrane systems: Reconstituting the enzyme in lipid nanodiscs provides a more physiologically relevant environment for functional studies compared to detergent-solubilized preparations.

  • In-cell NMR: This emerging approach allows for structural studies of proteins within living cells, potentially revealing how cellular factors influence enzyme conformation and activity.

  • CRISPR-based genome editing in chloroplasts: Advances in chloroplast genome editing could enable precise modification of the native enzyme in planta, allowing for structure-function studies in the native context.

These approaches could help resolve outstanding questions about how electron transfer occurs through the complex, how different subunits contribute to catalysis, and how the enzyme responds to changing environmental conditions in vivo.

What are the potential applications of understanding NAD(P)H-quinone oxidoreductase function in agricultural stress resistance?

Understanding NAD(P)H-quinone oxidoreductase function could have significant implications for agricultural stress resistance through several mechanisms:

  • Oxidative stress protection: The superoxide scavenging function of NAD(P)H-quinone oxidoreductase suggests it could be a target for enhancing plant tolerance to conditions that generate reactive oxygen species, such as drought, high light, or temperature extremes .

  • Photosynthetic efficiency: By understanding how this enzyme contributes to cyclic electron flow around photosystem I, researchers could develop strategies to optimize photosynthetic efficiency under varying environmental conditions.

  • Developmental adaptation: The light-dark cycle response patterns observed in bean leaves suggest the enzyme participates in developmentally regulated adaptation to changing light conditions, which could be leveraged to improve crop establishment .

  • Biomarker development: Changes in enzyme expression or activity could serve as early indicators of plant stress, enabling timely intervention in agricultural settings.

  • Genetic improvement strategies: Identifying natural variants with enhanced enzyme function could guide breeding programs or genetic engineering approaches to develop more resilient crop varieties.

Research in this area should focus on comparing enzyme function across varieties with different stress tolerance profiles and conducting field trials to validate laboratory findings under realistic agricultural conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.