Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

This recombinant protein corresponds to the full-length ndhE gene product (UniProt ID: A4GGE8) from Phaseolus vulgaris (common bean), a 101-amino acid polypeptide (11.9 kDa) involved in chloroplast NAD(P)H dehydrogenase (NDH) complexes . The enzyme participates in electron transfer from NAD(P)H to plastoquinone, contributing to proton gradient formation essential for ATP synthesis .

Biochemical Characteristics

Key specifications of the recombinant protein include:

PropertyDetail
Expression SystemE. coli with N-terminal His tag
Purity>90% (SDS-PAGE verified)
SequenceMIFEHALVLSAFLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDFFDRRQLKGN...LLNK
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water with 5–50% glycerol

The protein exhibits structural features typical of NDH subunits, including conserved domains for quinone binding and electron transfer .

Production and Quality Control

The recombinant protein is produced via codon-optimized expression in E. coli, followed by affinity chromatography purification . Critical quality metrics include:

  • Identity Verification: Mass spectrometry matching to theoretical molecular weight

  • Functional Integrity: Maintenance of secondary structure confirmed by circular dichroism

  • Stability: 12-month shelf life at -80°C when aliquoted

Functional Role in Chloroplasts

As part of the NDH complex, this subunit facilitates:

  • Plastoquinone reduction using NAD(P)H electrons

  • Cyclic electron flow around Photosystem I

  • Stress response mechanisms under high-light conditions

Mutational studies in homologous systems show that conserved residues (e.g., His-80, Glu-247) regulate FAD cofactor binding and conformational stability .

Research Applications

ApplicationExperimental UseSource
Enzyme kineticsSubstrate affinity measurements for quinone analogs
Structural studiesX-ray crystallography sample preparation
Plant stress responseKnockout mutant comparisons in model organisms
Diagnostic developmentELISA calibration standard for NDH complex analysis

Handling Considerations

Critical protocols for maintaining functionality:

  • Reconstitution: Centrifuge lyophilized powder before adding sterile water

  • Avoidance: >3 freeze-thaw cycles degrade activity by 40%

  • Working solutions: Stable for 7 days at 4°C with 50% glycerol

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Phaseolus vulgaris (Kidney bean) (French bean)
Target Names
ndhE
Target Protein Sequence
MIFEHALVLSAFLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDFFDRRQLKGN IFSIFVIAVAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. This process couples the redox reaction with proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: pvu:PhvuCp67

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NAD(P)H-quinone oxidoreductase subunit 4L in Phaseolus vulgaris chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 4L functions as an integral component of the chloroplast NDH complex, which plays a critical role in cyclic electron transport during photosynthesis. This complex catalyzes the translocation of protons linked to oxidoreductase reactions, specifically acting on NAD(P)H with quinone as an acceptor. In Phaseolus vulgaris, this enzyme participates in photosynthetic electron flow, particularly during cyclic electron transport, which helps balance the ATP/NADPH ratio produced during photosynthesis. The complex is particularly important under stress conditions when linear electron flow may be limited .

How is NAD(P)H-quinone oxidoreductase subunit 4L structurally integrated into the chloroplast NDH complex?

NAD(P)H-quinone oxidoreductase subunit 4L functions as part of the membrane-embedded domain of the chloroplast NDH complex. Structural studies indicate that this subunit contributes to the proton-pumping machinery of the complex. The protein contains transmembrane domains that anchor it within the thylakoid membrane, where it participates in electron transport coupled to proton translocation. This positioning is critical for maintaining the proton gradient across the thylakoid membrane, which drives ATP synthesis during photosynthesis .

What expression patterns does NAD(P)H-quinone oxidoreductase subunit 4L exhibit in different tissues of Phaseolus vulgaris?

While specific data for NAD(P)H-quinone oxidoreductase subunit 4L in Phaseolus vulgaris is limited, insights can be drawn from related NADPH oxidases in this species. For instance, PvRbohB (a different NADPH oxidase) accumulates abundantly in shoots, roots, and nodules of Phaseolus vulgaris. Similar patterns might be expected for NAD(P)H-quinone oxidoreductase subunit 4L, with likely highest expression in photosynthetically active tissues where the NDH complex functions in electron transport .

What are the optimal conditions for expressing recombinant Phaseolus vulgaris NAD(P)H-quinone oxidoreductase subunit 4L?

Optimized Expression Protocol:

  • Vector Selection: Use pET-based expression systems with T7 promoter for bacterial expression or plant-specific vectors for plant-based expression systems.

  • Host System:

    • For bacterial expression: E. coli BL21(DE3) or Rosetta strains

    • For plant expression: Nicotiana benthamiana transient expression system

  • Expression Conditions:

    ParameterBacterial SystemPlant System
    Temperature18-20°C22-24°C
    Induction0.1-0.5 mM IPTGN/A
    Duration16-20 hours3-5 days post-infiltration
    Media supplements5% glycerol, membrane protein-specific additivesStandard MS media
  • Protein Extraction: Use gentle detergent-based extraction (0.5-1% DDM or LMNG) for membrane protein solubilization from thylakoid membranes.

The process must account for the membrane-associated nature of this protein, as it naturally resides in the chloroplast thylakoid membrane. Including chlorophyll synthesis precursors in expression systems may enhance proper folding, as this protein functions in coordination with photosynthetic machinery .

What purification strategies are most effective for recombinant NAD(P)H-quinone oxidoreductase subunit 4L?

A multi-step purification approach is recommended:

  • Initial Extraction: Solubilize membrane fractions using mild detergents like n-dodecyl-β-D-maltoside (DDM) at 0.5-1% concentration.

  • Affinity Chromatography: If expressing with affinity tags (His6 or Strep-tag), use IMAC or Strep-Tactin columns with detergent-containing buffers.

  • Size Exclusion Chromatography: Further purify using Superdex 200 columns to separate the protein from aggregates and other contaminants.

  • Ion Exchange Chromatography: Optional refinement step using Q-Sepharose or SP-Sepharose depending on the protein's isoelectric point.

  • Quality Control Assessments:

    MethodParameter MeasuredAcceptance Criteria
    SDS-PAGEPurity>90% single band
    Western blotIdentityPositive signal with specific antibodies
    Circular dichroismSecondary structureCharacteristic α-helical pattern
    Activity assayEnzyme functionality>70% of theoretical activity

The purification process should be performed at 4°C throughout to maintain protein stability and prevent degradation. This approach is designed based on standard protocols for chloroplastic membrane proteins, similar to those used for related NDH complex subunits .

How does the expression of NAD(P)H-quinone oxidoreductase subunit 4L change under various environmental stresses?

Environmental stresses significantly modulate the expression and activity of NAD(P)H-quinone oxidoreductase subunit 4L as part of the plant's adaptive response. Under high light conditions, expression typically increases to support enhanced cyclic electron flow, which helps dissipate excess excitation energy. Similar upregulation occurs under drought stress, where maintaining photosynthetic efficiency becomes crucial.

Expression Profile Under Different Stresses:

Stress ConditionExpression ChangePhysiological Significance
High light↑↑ (strong increase)Enhanced cyclic electron flow to protect photosystem I
Drought↑ (moderate increase)Maintenance of proton gradient for ATP synthesis
Cold↑ (moderate increase)Protection against photoinhibition
Heat↑↑ (strong increase)Stabilization of photosynthetic apparatus
Nutrient limitationVariable responseDependent on specific nutrient and severity

The regulatory mechanisms governing these changes likely involve both transcriptional and post-translational processes. For experimental validation, researchers should employ qRT-PCR for transcript analysis alongside western blotting with specific antibodies to monitor protein levels. Additionally, non-denaturing gel electrophoresis can help assess the integrity of the NDH complex under stress conditions .

What protein-protein interactions does NAD(P)H-quinone oxidoreductase subunit 4L form within the NDH complex?

NAD(P)H-quinone oxidoreductase subunit 4L forms critical interactions with multiple proteins within the NDH complex, contributing to structural integrity and electron transfer functionality. Based on structural studies of chloroplast NDH complexes, these interactions include:

  • Core Complex Interactions:

    • Direct associations with NDH-A (NdhA) through transmembrane domain interfaces

    • Interactions with NDH-J (NdhJ) via hydrophobic regions

    • Stabilizing contacts with NDH-K (NdhK) that help position the quinone binding site

  • Peripheral Subunit Interactions:

    • Connections with NDH-M (NdhM) that link membrane and stromal domains

    • Functional coupling with NDH-H (NdhH) as part of the proton-pumping apparatus

These interactions can be identified using techniques such as:

  • Chemical cross-linking followed by mass spectrometry

  • Co-immunoprecipitation with antibodies against NDH subunits

  • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

  • Cryo-electron microscopy to visualize the entire complex architecture

Understanding these interactions provides insights into both the assembly process of the NDH complex and the electron transport pathways through the complex during photosynthesis .

How does site-directed mutagenesis of conserved residues in NAD(P)H-quinone oxidoreductase subunit 4L affect NDH complex function?

Site-directed mutagenesis of conserved residues in NAD(P)H-quinone oxidoreductase subunit 4L reveals critical functional domains within this protein. Based on structure-function analyses of related NDH complexes, the following residue categories are particularly significant:

Key Functional Residues and Mutagenesis Effects:

Residue TypeLocationMutation EffectFunctional Impact
Transmembrane histidinesTM helicesSeverely compromisedDisruption of proton channels
Quinone-binding pocket residuesMembrane interfaceReduced activityImpaired electron acceptance
Interface cysteinesSubunit boundariesComplex destabilizationCompromised assembly
Conserved acidic residuesStromal loopsVariable effectsAltered regulatory properties

To effectively study these mutations, researchers should employ chloroplast transformation techniques for Phaseolus vulgaris or model systems with homologous proteins. Phenotypic analyses should include chlorophyll fluorescence measurements (particularly post-illumination fluorescence rise) to assess NDH activity, growth measurements under fluctuating light conditions, and biochemical assays of isolated complexes to determine electron transport rates. Protein accumulation should be verified by immunoblotting to distinguish between assembly/stability defects and functional defects with intact complexes .

How can researchers troubleshoot inconsistent activity measurements of recombinant NAD(P)H-quinone oxidoreductase subunit 4L?

Inconsistent activity measurements of recombinant NAD(P)H-quinone oxidoreductase subunit 4L can stem from multiple sources. A systematic troubleshooting approach includes:

  • Protein Quality Assessment:

    • Verify protein folding using circular dichroism

    • Check for degradation using fresh SDS-PAGE analysis

    • Confirm incorporation of essential cofactors through absorption spectroscopy

  • Assay Condition Optimization:

    ParameterCommon IssuesSolutions
    pHEnzyme has narrow pH optimumTest pH range 6.0-8.5 in 0.5 unit increments
    TemperatureActivity highly temperature-dependentMaintain constant temperature (±0.5°C) during assays
    Detergent concentrationToo high: enzyme destabilization
    Too low: aggregation
    Titrate detergent concentration
    Substrate qualityNAD(P)H oxidation before assayPrepare fresh solutions; measure A340 before use
    Quinone solubilityPoor solubility or precipitationUse appropriate carriers; verify homogeneity
  • Instrument Calibration:

    • Ensure spectrophotometer wavelength accuracy using standards

    • Check for consistent light path using neutral density filters

  • Data Analysis Approaches:

    • Calculate coefficients of variation between technical replicates (should be <10%)

    • Use multiple calculation methods (initial rates vs. progress curves)

    • Apply appropriate statistical tests for significance

  • Experimental Design Considerations:

    • Always include positive controls (commercial enzymes if available)

    • Run parallel assays with different detection methods when possible

    • Consider the impact of light during assays, as photosynthetic proteins may be light-sensitive

What are the critical controls needed when studying the effects of post-translational modifications on NAD(P)H-quinone oxidoreductase subunit 4L?

When investigating post-translational modifications (PTMs) of NAD(P)H-quinone oxidoreductase subunit 4L, implementing appropriate controls is essential for generating reliable data:

Essential Controls for PTM Studies:

  • Negative Controls:

    • Non-modified recombinant protein (expressed in systems lacking specific PTM enzymes)

    • Site-directed mutants where potential modification sites are replaced with non-modifiable amino acids

    • Samples treated with specific PTM-removing enzymes (phosphatases, deubiquitinases)

  • Positive Controls:

    • Chemically modified proteins with defined modification patterns

    • Co-expressed protein with PTM-introducing enzymes

    • Related proteins known to undergo similar modifications

  • Validation Controls:

    • Multiple detection methods (e.g., anti-phospho antibodies and ProQ Diamond staining)

    • Mass spectrometry controls including isotope-labeled standards

    • Time-course studies to capture dynamic modification patterns

  • Biological Relevance Controls:

    Control TypePurposeImplementation
    Physiological stressVerify natural inductionCompare normal vs. stress conditions
    Developmental stageAssess age-dependent modificationCompare young vs. mature tissues
    Competitive inhibitionConfirm modification pathwayApply specific pathway inhibitors
    In vivo confirmationValidate in vitro findingsTransgenic expression with reporters
  • Quantification Controls:

    • Standard curves with defined amounts of modified and unmodified peptides

    • Internal reference proteins with known modification states

    • Replicate biological samples to account for natural variation

These controls help distinguish genuine PTM events from artifacts and enable quantitative assessment of modification stoichiometry, which is crucial for understanding the physiological significance of these modifications .

How does NAD(P)H-quinone oxidoreductase subunit 4L contribute to cyclic electron flow optimization in varying light conditions?

NAD(P)H-quinone oxidoreductase subunit 4L plays a crucial role in modulating cyclic electron flow (CEF) under fluctuating light conditions, contributing to photosynthetic efficiency and photoprotection. Recent research has revealed several key mechanisms:

The protein participates in rapid adjustments to changing light intensities through its integration in the chloroplast NDH complex. During high light periods, enhanced CEF helps dissipate excess excitation energy and prevents photodamage to photosystem I. Conversely, under low light conditions, the complex maintains basal CEF activity to balance the ATP/NADPH ratio for optimal carbon assimilation.

Response Dynamics to Light Transitions:

Light TransitionResponse TimeMolecular ChangesPhysiological Effect
Dark → Light30-60 secondsActivation of pre-existing complexRapid initiation of CEF
Low → High Light3-5 minutesIncreased complex assemblyEnhanced photoprotection
High → Low Light10-15 minutesGradual complex disassemblyEnergy conservation
Fluctuating LightContinuousDynamic association with PSIMaintained redox balance

Advanced chlorophyll fluorescence techniques, including measurement of post-illumination fluorescence rise, have enabled researchers to quantify these dynamics in vivo. Additionally, thylakoid membrane fractionation combined with blue-native gel electrophoresis has revealed changes in NDH complex assembly states corresponding to different light regimes.

Current research frontiers include investigating the redox-dependent regulation of the complex and potential phosphorylation sites that may serve as rapid switches for activity modulation. These studies provide critical insights into how plants optimize photosynthetic efficiency across variable environmental conditions .

What are the latest techniques for studying the in vivo dynamics of NAD(P)H-quinone oxidoreductase subunit 4L?

The study of in vivo dynamics of NAD(P)H-quinone oxidoreductase subunit 4L has advanced significantly with the development of novel techniques that combine molecular biology, biochemistry, and advanced imaging approaches:

Cutting-Edge Methodological Approaches:

  • Fluorescent Protein Fusions:

    • C-terminal and internal fluorescent protein tags compatible with chloroplast targeting

    • Photoconvertible fluorescent proteins to track protein turnover rates

    • Split-GFP complementation to visualize protein-protein interactions within the complex

  • Advanced Microscopy Techniques:

    TechniqueResolutionApplicationLimitations
    FRAP (Fluorescence Recovery After Photobleaching)Diffraction-limitedProtein mobility in thylakoidsRequires fluorescent tags
    FLIM (Fluorescence Lifetime Imaging)Diffraction-limitedProtein conformation changesComplex data interpretation
    Super-resolution microscopy (PALM/STORM)10-30 nmNanoscale organizationSpecialized equipment required
    Cryo-electron tomography3-5 nmNative membrane architectureSample preparation challenges
  • Quantitative Proteomics:

    • Pulsed SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to measure protein turnover

    • Targeted mass spectrometry with heavy-labeled peptide standards

    • Proximity labeling techniques (BioID, APEX) to identify transient interaction partners

  • Genetic Approaches:

    • Inducible expression systems to control timing of protein production

    • CRISPR/Cas9-based genome editing for tagging endogenous proteins

    • Conditional knockdown systems to study loss-of-function phenotypes

  • Functional Imaging:

    • Chlorophyll fluorescence imaging combined with protein localization

    • Simultaneous measurement of membrane potential and protein dynamics

    • Correlative light and electron microscopy to link localization with ultrastructure

These approaches collectively provide unprecedented insights into the dynamic behavior of this protein within the living cell, revealing its movement, interactions, and functional states under various physiological conditions and developmental stages .

How do emerging computational approaches contribute to understanding NAD(P)H-quinone oxidoreductase subunit 4L function?

Computational approaches have emerged as powerful tools for elucidating the function and behavior of NAD(P)H-quinone oxidoreductase subunit 4L at multiple scales, from atomic interactions to system-level effects:

Computational Methods in Current Research:

  • Structural Bioinformatics:

    • Homology modeling based on related bacterial and mitochondrial complex I structures

    • Molecular dynamics simulations of protein-membrane interactions

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of electron transfer pathways

  • Systems Biology Approaches:

    ApproachApplicationKey Insights
    Flux balance analysisMetabolic impact predictionQuantification of CEF contribution to ATP production
    Kinetic modelingTemporal dynamicsIdentification of rate-limiting steps in electron transfer
    Gene regulatory networksExpression coordinationCo-regulation patterns with other photosynthetic genes
    Multi-scale modelingIntegrated predictionLinking molecular events to whole-plant physiology
  • Machine Learning Applications:

    • Prediction of post-translational modification sites

    • Pattern recognition in gene expression data across conditions

    • Classification of protein-protein interaction interfaces

  • Evolutionary Analyses:

    • Ancestral sequence reconstruction to trace functional evolution

    • Comparative genomics across plant lineages

    • Identification of co-evolving residues suggesting functional coupling

  • Virtual Screening and Drug Design:

    • Identification of small molecules that modulate NDH complex activity

    • Structure-based design of chemical probes for mechanism studies

    • Prediction of herbicide binding sites and resistance mechanisms

These computational approaches have revealed conserved functional motifs, predicted critical residues for complex assembly, and identified potential regulatory mechanisms that modulate activity in response to environmental cues. Integration of these computational predictions with experimental validation has accelerated understanding of this complex protein's role in photosynthetic electron transport .

What are the most effective strategies for generating antibodies against Phaseolus vulgaris NAD(P)H-quinone oxidoreductase subunit 4L?

Generating effective antibodies against Phaseolus vulgaris NAD(P)H-quinone oxidoreductase subunit 4L presents specific challenges due to its membrane-associated nature and potential species-specific epitopes. Current methodological advances offer multiple strategic approaches:

Optimized Antibody Generation Protocol:

  • Antigen Design Options:

    • Recombinant expression of hydrophilic domains

    • Synthetic peptides from predicted surface-exposed regions

    • Fusion proteins with carrier molecules to enhance immunogenicity

    • Multiple antigen peptide (MAP) systems for challenging epitopes

  • Selection Strategy Matrix:

    Antigen TypeAdvantagesLimitationsRecommended Applications
    Full-length proteinComplete epitope rangeDifficult expressionProtein localization studies
    Peptide cocktailsTargeting multiple regionsLower affinityHigh-specificity western blots
    Single peptideHigh specificityLimited applicationsPhospho-specific detection
    Domain-specificGood compromiseModerate complexityMost general applications
  • Host Selection Considerations:

    • Rabbits: Good for polyclonal antibodies with moderate quantity

    • Chickens: Excellent for obtaining high IgY yields from eggs

    • Mice/rats: Necessary for monoclonal antibody development

    • Llamas/alpacas: Single-domain antibodies for special applications

  • Purification and Validation:

    • Affinity purification against the immunizing antigen

    • Cross-adsorption against related proteins to reduce cross-reactivity

    • Western blot validation using wild-type and knockout/knockdown samples

    • Immunohistochemistry to confirm proper localization pattern

The most effective approach typically involves using peptide antigens from regions that show sequence divergence from related proteins but conservation within Phaseolus vulgaris. Given the known cross-reactivity patterns observed in search results and , careful epitope selection targeting unique regions of the Phaseolus vulgaris protein is essential. For validation, comparing antibody reactivity between wild-type plants and those with reduced expression (via RNAi or CRISPR) provides definitive confirmation of specificity .

How can researchers optimize expression systems for studying NAD(P)H-quinone oxidoreductase subunit 4L interactions with other chloroplast proteins?

Optimizing expression systems for studying NAD(P)H-quinone oxidoreductase subunit 4L interactions requires specialized approaches that maintain the protein's native conformation and interaction capabilities:

Expression System Optimization Strategies:

  • Chloroplast-Mimicking Expression Systems:

    • Chlamydomonas reinhardtii chloroplast transformation

    • Tobacco chloroplast transformation

    • Cell-free expression systems supplemented with thylakoid membrane components

  • Co-expression Approaches:

    Expression SystemAdvantagesKey ModificationsBest Applications
    E. coli-basedHigh yield, simplicityRare codon optimization, membrane-mimetic additivesStructural studies
    Insect cellBetter foldingBaculovirus optimization, reduced temperatureComplex reconstitution
    Plant cell cultureNative modificationsInducible promoters, tagged constructsPhysiological interactions
    Split-protein systemsIn vivo detectionComplementary fragment designDirect interaction screening
  • Membrane Environment Engineering:

    • Nanodiscs with plant lipid compositions

    • Amphipol stabilization of membrane proteins

    • GraDeR (Gradient-based Detergent Removal) for gentle complex isolation

    • Lipid cubics phase crystallization compatibility

  • Affinity Tag Strategies:

    • Tandem affinity purification (TAP) tags for complex isolation

    • HaloTag for covalent capture and enhanced solubility

    • Split-intein mediated protein ligation for tag removal

    • Twin-Strep tag for native elution conditions

These optimized systems allow researchers to study interactions in near-native environments while maintaining sufficient expression levels for biochemical and structural studies. When combined with techniques such as cross-linking mass spectrometry or hydrogen-deuterium exchange mass spectrometry, these expression systems provide powerful platforms for mapping the intricate interaction network of NAD(P)H-quinone oxidoreductase subunit 4L within the chloroplast .

What are the most promising research directions for understanding NAD(P)H-quinone oxidoreductase subunit 4L's role in plant adaptation to climate change?

As climate change intensifies, understanding how NAD(P)H-quinone oxidoreductase subunit 4L contributes to plant adaptation becomes increasingly crucial. Several promising research directions emerge at the intersection of molecular biology, plant physiology, and environmental science:

  • Climate Stress Adaptation Mechanisms:
    Research into how this protein's regulation and activity change in response to increased temperature, CO2 levels, and drought conditions will provide insights into natural adaptation mechanisms. Such studies should combine controlled environment experiments with field trials in climate-analog locations to assess real-world responses.

  • Genetic Diversity and Breeding Applications:

    Research ApproachKey QuestionsPotential Applications
    Natural variation studiesHow do genetic variants affect stress tolerance?Marker-assisted selection
    TILLING populationsWhich mutations enhance NDH function?Non-GMO crop improvement
    Precision engineeringCan targeted modifications improve efficiency?Climate-resilient varieties
    Allele miningAre there superior alleles in wild relatives?Broadening the genetic base
  • Systems-Level Integration:
    Investigating how NAD(P)H-quinone oxidoreductase subunit 4L coordinates with other photosynthetic components under fluctuating conditions will reveal emergent properties of plant adaptation. Multi-omics approaches combining transcriptomics, proteomics, and metabolomics across time series during stress events can capture these complex relationships.

  • Novel Biotechnological Applications:
    Exploring the potential to modulate NDH complex activity through targeted approaches could lead to crops with enhanced photosynthetic efficiency under suboptimal conditions. This might include developing chemical modulators of activity or engineering regulatory elements for environmentally responsive expression.

These research directions collectively promise to advance our understanding of plant adaptation strategies while potentially contributing to the development of climate-resilient crops through targeted breeding or biotechnological approaches .

How does understanding NAD(P)H-quinone oxidoreductase subunit 4L contribute to improving crop productivity?

Understanding NAD(P)H-quinone oxidoreductase subunit 4L's functions opens multiple avenues for improving crop productivity through both fundamental knowledge and applied approaches:

Productivity Enhancement Pathways:

  • Photosynthetic Efficiency Optimization:
    The NDH complex contributes to cyclic electron flow, which helps maintain optimal ATP/NADPH ratios for carbon fixation. Modulating NAD(P)H-quinone oxidoreductase subunit 4L activity could potentially enhance photosynthetic efficiency under fluctuating field conditions, directly impacting biomass production and yield.

  • Stress Resilience Mechanisms:

    Stress TypeNDH Complex ContributionProductivity Impact
    DroughtMaintenance of photosynthesis under water limitationReduced yield losses
    Heat stressProtection against photoinhibitionSustained productivity during heat waves
    Light fluctuationsRapid adjustment to changing light conditionsImproved carbon gain in canopy environments
    Combined stressesIntegrated response to field conditionsStability of yield across seasons
  • Developmental Optimization:
    Understanding the role of NAD(P)H-quinone oxidoreductase subunit 4L in leaf development and senescence could lead to crops with extended photosynthetic duration. Research into how this protein's activity changes throughout the growing season may identify key intervention points to extend the productive period of crops.

  • Practical Applications:

    • Screening germplasm collections for natural variation in NDH activity

    • Developing high-throughput phenotyping methods based on chlorophyll fluorescence

    • Creating genetic markers for NDH complex optimization in breeding programs

    • Engineering regulatory elements for context-dependent expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.