The full-length recombinant psbB protein (1-508 amino acids) shares high sequence homology with other plant CP47 apoproteins. For P. vulgaris, the amino acid sequence includes conserved domains critical for chlorophyll binding and interaction with other PSII subunits (e.g., PsbH, PsbL, PsbT) .
| Amino Acid Sequence (Partial) |
|---|
| MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM... |
| Continued sequence available in |
Expression System: Expressed in E. coli (inferred from homologous systems in lettuce and spinach CP47 production) .
His-Tag: N-terminal His-tag facilitates affinity purification via nickel-chelating chromatography .
Reconstitution: Dissolved in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .
Storage: Lyophilized or glycerol-stabilized aliquots stored at -20°C/-80°C to avoid degradation .
The recombinant psbB protein serves as a model to investigate early PSII assembly steps. In Synechocystis sp. PCC 6803, analogous CP47 binds chlorophyll a and β-carotene, forming preassembled pigment-protein complexes with low molecular mass subunits (e.g., PsbH, PsbL, PsbT) . These interactions are critical for PSII core stability.
Recombinant psbB is used as an antigen in ELISA kits for quantifying anti-psbB antibodies or monitoring psbB expression levels in plant tissues .
Recombinant CP47 binds chlorophyll a and β-carotene, though its fluorescence quantum yield is lower than native PSII complexes. This suggests partial pigment arrangement or altered protein conformation in vitro .
| Spectroscopic Properties |
|---|
| Chlorophyll a Binding |
| 77 K Emission Shift |
Purified CP47 co-purifies with PsbH, PsbL, and PsbT, indicating pre-existing interactions critical for PSII core assembly .
The psbB gene is part of the psbB operon, which also encodes PSII and cytochrome b<sub>6</sub>f complex components. In Populus deltoides, RNA processing of this operon generates mono- and oligo-cistronic transcripts, reflecting differential expression demands during chloroplast biogenesis .
A core component of the Photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis.
KEGG: pvu:PhvuCp50
CP47 functions as a core antenna protein within PSII, binding chlorophyll molecules and facilitating light energy transfer to the reaction center. This protein contains multiple transmembrane helices and interacts with several small transmembrane subunits including PsbH, PsbL, PsbM, and PsbT, forming what is known as CP47 mod (CP47 module) . The N-terminal tail of PsbH specifically interacts with helices II and III of CP47 and folds over its cytoplasmic (stromal) surface. CP47 plays crucial roles in binding chlorophyll and β-carotene molecules that participate in light harvesting and energy transfer to the reaction center .
Phaseolus vulgaris possesses a relatively compact genome (514 Mb) with 11 chromosomes, providing a favorable model for studying gene expression and regulation . The genomic context surrounding psbB influences its expression patterns, with several factors impacting gene regulation:
Recombination rates across the P. vulgaris genome average 2.13 cM/Mb but vary significantly by chromosomal region
Recombination is highly repressed around centromeres but more frequent in peri-centromeric regions
Linkage disequilibrium (LD) patterns differ between the Mesoamerican genepool (stronger LD) and Andean genepool (more rapid LD decay)
These genomic characteristics create unique expression environments that may impact the regulation of photosynthetic genes including psbB.
CP47 participates in multiple essential protein-protein interactions during PSII assembly and function:
CP47 mod incorporates transmembrane subunits PsbH, PsbL, PsbM, and PsbT, with each contributing distinct functional properties to the complex
The PsbH subunit helps bind chlorophyll and β-carotene molecules and may assist in detaching assembly factor Pam68 during biogenesis
Two Hlip heterodimers (HliA/C and HliB/C) associate with CP47 mod during stress conditions, likely providing photoprotection
Psb34 protein interacts with CP47 at its cytoplasmic side and may promote detachment of Hlip heterodimers during later stages of PSII formation
Psb35 binds to CP47 mod to stabilize Hlip binding and increase complex stability in darkness
These interactions form a complex network essential for proper assembly, stability, and function of PSII complexes.
Genetic diversity within Phaseolus vulgaris genepools creates variable contexts for psbB expression and CP47 function. Research indicates significant differences between the Mesoamerican and Andean genepools:
Mesoamerican accessions show stronger linkage disequilibrium patterns compared to Andean varieties
Linkage disequilibrium decays more rapidly within the Andean genepool
Gene positioning relative to recombination hotspots varies across accessions
These genetic differences potentially impact the expression, structure, and function of photosynthetic proteins including CP47. Researchers investigating recombinant CP47 should consider genepool origin when selecting expression systems and interpreting functional data, as post-translational modifications and folding environments may differ. Methodologically, this requires careful selection of germplasm for genetic transformation and comprehensive genotyping of experimental materials.
RC47 complexes (containing CP47 but lacking CP43) represent heterogeneous mixtures formed during both PSII assembly and repair pathways . Current research indicates several key differences:
Assembly-pathway RC47 complexes lack the Mn₄CaO₅ cluster but retain capability for light-driven electron transfer from tyrosine Yz to QA
Repair-pathway RC47 often contains assembly factors Ycf48, RubA, and CyanoP
The Psb28 subunit interacts with the cytoplasmic regions of D1, D2, and CP47, inducing substantial structural changes that distort the QB pocket
These conformational changes may stabilize reduced QA and protect PSII from photodamage by reducing singlet oxygen production
Methodologically, distinguishing between assembly and repair-associated RC47 requires techniques such as pulse-chase labeling combined with immunoprecipitation and blue-native gel electrophoresis to track the temporal sequence of protein assembly and complex formation.
Post-translational modifications (PTMs) of CP47 play critical roles in protein folding, stability, and interaction with other PSII components. When expressing recombinant CP47 in heterologous systems, researchers must consider:
Phosphorylation status: CP47 phosphorylation affects its stability and interaction with assembly factors
Glycosylation patterns: Differences in N-glycosylation machinery between expression systems can alter protein folding
Proteolytic processing: Correct processing of transit peptides and signal sequences is essential for proper localization
To address these challenges, researchers should implement:
Site-directed mutagenesis to investigate the impact of specific PTM sites
Mass spectrometry-based PTM mapping to compare native and recombinant proteins
Co-expression of chaperones and assembly factors to improve folding and assembly
Expression and purification of recombinant CP47 from Phaseolus vulgaris requires careful optimization due to its membrane-associated nature and complex structure. The following methodological approach has proven effective:
Expression System Selection:
Escherichia coli-based systems are suitable for expression of CP47 fragments but often struggle with full-length protein
Plant-based transient expression systems (Nicotiana benthamiana) provide appropriate post-translational machinery
Cell-free expression systems allow rapid optimization but at lower yields
Purification Protocol:
Membrane solubilization using mild detergents (n-dodecyl-β-D-maltoside at 1-2%)
Immobilized metal affinity chromatography using His6-tagged constructs
Size exclusion chromatography to separate monomeric from aggregated protein
Optional: Ion exchange chromatography for removal of contaminants
Key considerations include maintaining chlorophyll association during purification and verifying protein folding through circular dichroism spectroscopy.
Analysis of CP47 protein interactions requires a combination of in vivo and in vitro approaches:
In Vivo Methods:
Split-GFP complementation assays to visualize interactions in plant cells
Co-immunoprecipitation with antibodies against known interaction partners (PsbH, PsbL, PsbM, and PsbT)
Proximity labeling using CP47-BioID fusion proteins to identify novel interaction partners
In Vitro Methods:
Surface plasmon resonance (SPR) to measure binding kinetics between purified proteins
Isothermal titration calorimetry (ITC) for thermodynamic analysis of interactions
Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces
When investigating stress-responsive interactions, researchers should examine associations with Hlip heterodimers (HliA/C and HliB/C) that bind CP47 during stress conditions to provide photoprotection .
CRISPR/Cas9-based genome editing has emerged as the method of choice for modifying psbB in common bean, with several considerations specific to this system:
Technical Protocol:
gRNA design targeting unique regions of psbB with minimal off-target potential
Delivery via Agrobacterium-mediated transformation of embryonic axes
Regeneration on selective media containing appropriate antibiotics
Screening via high-resolution melting analysis followed by Sanger sequencing
Efficiency Considerations:
Transformation efficiency varies significantly between bean genotypes, with Mesoamerican types generally more amenable to transformation
The recombination rate of 2.13 cM/Mb across the genome impacts homology-directed repair efficiency
Single-stranded oligonucleotide donors improve precise editing outcomes
A two-vector system (Cas9 and gRNA on separate plasmids) has shown superior editing efficiency compared to single-vector approaches in common bean.
Common bean is susceptible to various pathogens that can influence photosynthetic efficiency through direct or indirect effects on PSII components. Research has shown that fungal pathogens including Fusarium oxysporum f.sp. phaseoli, Sclerotium rolfsii, and Rhizoctonia solani can impact photosynthetic efficiency through:
Induction of oxidative stress that damages PSII components
Activation of defense responses that reallocate resources away from photosynthesis
Direct effects on chloroplast integrity through toxin production
Varieties with documented resistance to these pathogens (such as Dandesu, Tinike, SER-125, Dursitu, and Chorie) may be valuable systems for investigating stress responses in CP47 and other photosynthetic proteins. Future research should explore the molecular mechanisms connecting pathogen resistance and photosynthetic efficiency.
While substantial research on CP47 structure and function has been conducted in model organisms (particularly cyanobacteria), transferring this knowledge to common bean presents several challenges:
Evolutionary divergence in protein sequences and post-translational modification patterns
Differences in thylakoid membrane lipid composition affecting protein-lipid interactions
Species-specific assembly factors and chaperones that may not be conserved
Future approaches should include:
Comparative structural biology to identify conserved and divergent domains
Heterologous complementation studies to test functional conservation
Development of bean-specific antibodies and proteomics resources
Fundamental research on CP47 has significant potential applications for crop improvement:
Potential Applications:
Engineering CP47 variants with enhanced stability under heat stress
Modifying chlorophyll-binding sites to optimize light harvesting under fluctuating light conditions
Improving the repair cycle of PSII to reduce photoinhibition under field conditions
Methodological Pathway:
Identify natural variation in psbB sequences across bean germplasm
Correlate sequence polymorphisms with photosynthetic performance under stress
Validate promising variants through targeted genome editing
Integrate modified alleles into elite breeding material
This research pathway bridges fundamental photosynthesis research with applied crop improvement goals, potentially addressing yield limitations in common bean production systems.