Recombinant Phenylobacterium zucineum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; PHZ_c0192; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Phenylobacterium zucineum (strain HLK1)
Target Names
mscL
Target Protein Sequence
MSIISEFREFIARGNVIDLAVGVIIGAAFNDIVKALVDNIVMPPIGLVLSGIDFSDLAWV LKPDDPATPALDAVAIQYGAFINTCIRFLIVAWAVFMLVKLVNVIRRREAEKPPEEKPAP TPQETLLMEIRDLLKRRAD
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phenylobacterium zucineum and what makes its MscL protein of interest to researchers?

Phenylobacterium zucineum is a facultative intracellular bacterial species that was first isolated from the human leukemia cell line K562. Unlike typical intracellular pathogens, P. zucineum establishes a stable parasitic relationship with host cells without disrupting their growth or morphology . This unique characteristic makes it biologically interesting, as it can maintain long-term associations with human cells—some infected cell lines have been maintained for nearly three years in laboratory settings .

The MscL (mechanosensitive channel of large conductance) protein is significant because it represents a critical mechanism for bacterial osmotic regulation. While the P. zucineum MscL hasn't been specifically characterized in the provided literature, MscL proteins generally function as safety valves that open in response to membrane tension, allowing rapid efflux of solutes to prevent cell lysis during osmotic shock . The study of P. zucineum MscL could provide insights into how this intracellular bacterium responds to osmotic challenges within the unique environment of human cells.

How does the genomic context of P. zucineum influence MscL expression and function?

The complete genome of P. zucineum consists of a circular chromosome (3,996,255 bp) and a circular plasmid (382,976 bp), encoding 3,861 putative proteins . While the specific genomic location of the MscL gene in P. zucineum is not directly specified in the provided literature, understanding the genomic context is crucial for recombinant expression studies.

P. zucineum possesses sophisticated regulatory mechanisms, including 154 transcriptional regulators in its chromosome and 16 in its plasmid, spanning families such as LysR, TetR, and MerR that control responses to environmental stresses . These regulators likely influence MscL expression under different osmotic conditions. Additionally, P. zucineum contains 17 extracytoplasmic function (ECF) sigma factors and numerous heat shock molecular chaperones that help the organism cope with various stresses , which may be relevant to MscL folding and membrane insertion.

What are the structural characteristics of bacterial MscL proteins and how might the P. zucineum variant differ?

Bacterial MscL proteins typically form homopentameric channels embedded in the cytoplasmic membrane. The three-dimensional structure of MscL from Mycobacterium tuberculosis has been solved and serves as a model for understanding other bacterial mechanosensitive channels . Each MscL subunit contains two transmembrane domains connected by a periplasmic loop, with cytoplasmic N-terminal and C-terminal domains.

What are the optimal expression systems and conditions for producing recombinant P. zucineum MscL?

For recombinant expression of P. zucineum MscL, consider the following methodological approach:

  • Expression Systems Selection:

    • E. coli BL21(DE3) is typically preferred for membrane protein expression due to its reduced protease activity

    • Cell-free expression systems may be valuable alternatives for potentially toxic membrane proteins

    • Mammalian cell expression systems could be considered given P. zucineum's adaptation to human cells

  • Vector Design Considerations:

    • Include a C-terminal or N-terminal affinity tag (His6, FLAG, etc.) for purification

    • Consider using inducible promoters (T7, tac) to control expression levels

    • Incorporate fusion partners (MBP, SUMO) to enhance solubility if needed

  • Expression Conditions:

    • Reduce expression temperature (16-25°C) to slow production and improve folding

    • Test various induction conditions (0.1-1.0 mM IPTG for T7 systems)

    • Supplement growth media with glycerol (0.5-2%) to provide additional carbon source and membrane components

The unique metabolism of P. zucineum, which includes complete pathways for glycolysis and the Entner-Doudoroff pathway , should be considered when optimizing expression conditions, as codon usage and metabolic requirements may influence recombinant protein production.

What purification strategies are most effective for obtaining functional recombinant P. zucineum MscL?

A comprehensive purification strategy for recombinant P. zucineum MscL should include:

  • Membrane Extraction Protocol:

    • Harvest cells and disrupt by sonication or French press

    • Separate membrane fraction through ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membranes using appropriate detergents

  • Detergent Selection Table:

DetergentCritical Micelle ConcentrationAdvantagesConsiderations
DDM0.17 mMGentle, maintains protein activityLarge micelles
LDAO1-2 mMSmall micelles, good for crystallizationCan be destabilizing
Fos-choline-140.12 mMHighly effective solubilizerMay be harsh for some proteins
Digitonin0.5 mMVery mild, good for sensitive proteinsExpensive, variable purity
  • Purification Steps:

    • Affinity chromatography (Ni-NTA for His-tagged constructs)

    • Size exclusion chromatography to separate protein-detergent complexes

    • Optional ion exchange chromatography for further purification

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism spectroscopy to verify secondary structure

    • Dynamic light scattering to assess homogeneity

Because P. zucineum has adapted to intracellular environments, particular attention should be paid to maintaining physiologically relevant conditions throughout purification to preserve the native conformation of MscL.

How can researchers verify the functionality of purified recombinant P. zucineum MscL?

Functional verification of purified recombinant P. zucineum MscL requires multiple complementary approaches:

  • Electrophysiological Characterization:

    • Reconstitute MscL into planar lipid bilayers

    • Perform patch-clamp recordings to measure channel conductance

    • Analyze gating properties in response to membrane tension

  • Reconstitution into Liposomes:

    • Incorporate purified MscL into liposomes of defined lipid composition

    • Perform fluorescent dye release assays in response to osmotic shock

    • Measure channel activity using stopped-flow spectrofluorimetry

  • Structural Verification:

    • Negative-stain electron microscopy to confirm pentameric assembly

    • Blue native PAGE to assess oligomeric state

    • Thermal stability assays (differential scanning fluorimetry) to evaluate protein folding

  • Functional Complementation:

    • Express recombinant P. zucineum MscL in MscL-deficient bacterial strains

    • Assess survival rates following hypoosmotic shock

    • Compare function with well-characterized MscL proteins from other species

The unique environmental adaptations of P. zucineum, including its extensive repertoire of stress response proteins and heat shock molecular chaperones , suggest that its MscL may have distinct functional properties worth characterizing in comparison to other bacterial MscL channels.

How can the unique intracellular lifestyle of P. zucineum inform research on its MscL protein's adaptation to host environments?

P. zucineum's ability to establish stable intracellular parasitism without disrupting host cell morphology raises intriguing questions about its MscL adaptation:

  • Host-Pathogen Interface Analysis:

    • Investigate whether MscL functions differently within host cell environments

    • Examine potential interactions between MscL and host cell membranes or proteins

    • Study MscL expression patterns during different stages of intracellular residence

  • Comparative Analysis Approach:

    • Construct phylogenetic trees of MscL proteins from intracellular vs. free-living bacteria

    • Identify amino acid signatures associated with intracellular adaptation

    • Perform molecular dynamics simulations to predict functional differences

  • Host Cell Response Assessment:

    • Determine if host cells recognize MscL as a pathogen-associated molecular pattern

    • Investigate potential immunomodulatory effects of MscL expression

    • Examine changes in host cell membrane properties in response to bacterial MscL

The genomic adaptation of P. zucineum for intracellular survival, including its extensive complement of heat shock proteins (33 molecular chaperones with 17 in its plasmid) , suggests sophisticated mechanisms for protein homeostasis that may extend to MscL function within host environments.

What research opportunities exist for exploring P. zucineum MscL as a potential drug target or biotechnological tool?

P. zucineum MscL offers several promising research avenues:

  • Antimicrobial Development Strategy:

    • Design compounds that inappropriately activate MscL, disrupting osmotic balance

    • Develop inhibitors that block channel closure, rendering bacteria vulnerable to osmotic shock

    • Target unique structural features of P. zucineum MscL not present in human proteins

  • Biotechnological Applications:

    • Engineer MscL as a controlled release mechanism for drug delivery systems

    • Develop biosensors for detecting membrane stress in various environments

    • Create nanopore technology for single-molecule detection and analysis

  • Structural Biology Opportunities:

    • Determine high-resolution structure of P. zucineum MscL using cryo-EM or X-ray crystallography

    • Compare structural dynamics with other bacterial MscL channels

    • Identify structural features that might contribute to intracellular adaptation

The unique biology of P. zucineum, particularly its stable association with human cells , makes its MscL channel an intriguing candidate for studying host-pathogen interactions and developing targeted antimicrobial strategies that exploit its role in bacterial survival.

How does the genomic island structure of P. zucineum influence the evolutionary context of its MscL protein?

The P. zucineum genome contains five acquired genomic islands (GIs) that contribute to its pathogenic capacity and environmental adaptation . While the specific location of the MscL gene relative to these GIs is not provided in the search results, this genomic architecture raises important evolutionary questions:

  • Evolutionary Analysis Framework:

    • Determine if MscL is located within or near any genomic islands

    • Perform comparative genomics across Phenylobacterium species to assess conservation

    • Analyze codon usage patterns to identify potential horizontal gene transfer events

  • Selective Pressure Assessment:

    • Calculate Ka/Ks ratios to determine evolutionary pressure on MscL

    • Identify conserved vs. variable regions within the protein sequence

    • Compare MscL sequences from bacteria with different ecological niches

  • Functional Divergence Investigation:

    • Examine whether MscL function has adapted specifically to intracellular lifestyle

    • Investigate potential co-evolution with other membrane components

    • Assess whether genomic islands contribute regulatory elements affecting MscL expression

P. zucineum's phylogenetic relationship with Caulobacter crescentus , a model organism for cell cycle research, offers an opportunity to understand how mechanosensitive channels evolve as bacteria adapt to specialized environmental niches such as intracellular parasitism.

What are common challenges in expressing and purifying recombinant P. zucineum MscL and how can they be addressed?

Researchers often encounter several technical challenges when working with recombinant membrane proteins like P. zucineum MscL:

  • Expression Challenges and Solutions:

ChallengePotential SolutionRationale
Toxicity to expression hostUse tightly controlled inducible systemsMinimizes basal expression during growth phase
Inclusion body formationLower expression temperature to 16-20°CSlows protein synthesis to allow proper folding
Poor membrane insertionCo-express with chaperones (GroEL/ES, DnaK)Assists proper folding and membrane integration
Low expression levelsOptimize codon usage for expression hostAddresses potential rare codon bias
  • Purification Obstacles:

    • Detergent-mediated protein aggregation can be addressed by screening multiple detergents

    • Loss of structural integrity during purification requires optimization of buffer conditions

    • Co-purification of host cell membrane proteins necessitates additional purification steps

  • Methodological Adaptations:

    • Consider fusion with fluorescent proteins to monitor expression and localization

    • Test extraction with multiple detergent combinations at varying concentrations

    • Implement on-column detergent exchange during purification

The complex membrane physiology of P. zucineum, which has adapted to both free-living and intracellular environments , may present unique challenges for recombinant expression systems designed for typical bacterial membrane proteins.

How can researchers address the challenge of maintaining functional conformation of P. zucineum MscL during structural studies?

Maintaining the functional conformation of mechanosensitive channels during structural studies presents significant challenges:

  • Stabilization Strategies:

    • Screen lipid-like detergents that better mimic native membrane environment

    • Consider nanodiscs or SMALPs (styrene maleic acid lipid particles) for membrane protein stabilization

    • Test protein stabilizing additives (glycerol, specific ions, cholesterol hemisuccinate)

  • Conformational State Control:

    • Use site-directed mutagenesis to stabilize specific functional states

    • Apply tension-mimicking amphipaths (e.g., lysophospholipids) to capture open states

    • Employ conformation-specific nanobodies or antibody fragments as crystallization chaperones

  • Technical Approach Refinement:

    • Implement high-throughput crystallization screening with specialized membrane protein screens

    • Consider lipidic cubic phase crystallization for maintaining membrane protein structure

    • Utilize cryo-EM for structure determination without crystallization

The unique evolutionary adaptations of P. zucineum MscL, potentially influenced by its intracellular lifestyle, may require specialized approaches to capture physiologically relevant conformational states that reflect its function within host cells.

What are best practices for analyzing contradictory data regarding P. zucineum MscL function or structure?

When faced with contradictory experimental results regarding P. zucineum MscL:

  • Systematic Validation Approach:

    • Verify protein identity through mass spectrometry and N-terminal sequencing

    • Confirm oligomeric state using multiple techniques (SEC-MALS, native PAGE, crosslinking)

    • Assess functional activity using complementary assays (electrophysiology, fluorescence-based assays)

  • Technical Variables Assessment:

    • Evaluate the impact of different detergents on protein structure and function

    • Test temperature sensitivity of protein properties

    • Examine effects of different lipid compositions on channel behavior

  • Reconciliation Strategy:

    • Develop working hypotheses that might explain the contradictory data

    • Design critical experiments specifically to test these hypotheses

    • Consider whether the protein exists in multiple functional states with different properties

  • External Validation:

    • Compare with known properties of well-characterized MscL proteins from other species

    • Collaborate with laboratories using different methodological approaches

    • Implement computational modeling to predict behavior under different conditions

The complex regulatory systems of P. zucineum, including its numerous transcriptional regulators and stress response proteins , suggest that its MscL may have sophisticated regulation mechanisms that could explain apparent contradictions in experimental results under different conditions.

How might the study of P. zucineum MscL contribute to understanding bacterial adaptation to intracellular environments?

Investigating P. zucineum MscL holds significant potential for advancing our understanding of bacterial adaptation to intracellular niches:

  • Comparative Studies Framework:

    • Analyze MscL sequences and functions across bacteria with different host-association patterns

    • Examine expression patterns in various microenvironments within host cells

    • Investigate potential interactions with host cell osmoregulatory mechanisms

  • Adaptation Hypothesis Testing:

    • Determine whether P. zucineum MscL sensitivity differs from free-living bacterial channels

    • Investigate if channel properties are optimized for the osmotic conditions inside human cells

    • Explore whether MscL contributes to persistence during host cell division

  • Evolutionary Implications:

    • Assess whether horizontal gene transfer contributed to MscL adaptation

    • Examine selective pressures on different functional domains of the protein

    • Investigate co-evolution with other membrane components important for intracellular survival

P. zucineum's unique ability to maintain stable associations with host cells over long periods makes it an excellent model for studying how mechanosensitive channels adapt to the challenges of intracellular life, potentially revealing new principles of host-pathogen co-evolution.

What emerging technologies could advance research on P. zucineum MscL structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of P. zucineum MscL:

  • Advanced Structural Methods:

    • Cryo-electron tomography of MscL in native membrane environments

    • Time-resolved X-ray crystallography to capture transitional states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Functional Analysis Innovations:

    • High-speed atomic force microscopy to visualize channel gating in real-time

    • Optogenetic approaches to control channel activity with light

    • Single-molecule FRET to measure conformational changes during gating

  • Computational Advances:

    • Enhanced molecular dynamics simulations of membrane tension effects

    • Machine learning approaches to predict functional properties from sequence

    • Quantum mechanics/molecular mechanics (QM/MM) simulations for detailed gating energetics

  • Cellular Imaging Breakthroughs:

    • Super-resolution microscopy to visualize MscL clustering in bacterial membranes

    • Correlative light and electron microscopy to connect function with structure

    • Live-cell imaging of fluorescently tagged MscL during osmotic challenges

The complex signaling and regulatory systems identified in P. zucineum , including numerous two-component systems and transcriptional regulators, suggest sophisticated control mechanisms that could be elucidated using these emerging technologies.

How can interdisciplinary approaches enhance our understanding of P. zucineum MscL in both basic science and applied contexts?

Interdisciplinary research strategies offer powerful frameworks for comprehensive investigation of P. zucineum MscL:

  • Cross-disciplinary Integration:

    • Combine structural biology with computational biology to model conformational dynamics

    • Integrate microbiology with host cell biology to understand contextual function

    • Merge biophysics with synthetic biology to develop engineered channel variants

  • Translational Research Pathways:

    • Apply pharmaceutical science principles to develop MscL-targeting antimicrobials

    • Utilize nanotechnology to develop MscL-based biosensors or delivery systems

    • Implement systems biology approaches to understand MscL within bacterial physiology networks

  • Methodological Synergy:

    • Combine in vitro biophysical measurements with in vivo functional studies

    • Link genomic analysis with protein function through multi-omics approaches

    • Integrate evolutionary analysis with structural studies to identify functional adaptations

The unique biology of P. zucineum, particularly its stable interaction with human cells without causing cytopathic effects , creates opportunities for novel interdisciplinary investigations at the intersection of microbiology, cell biology, biophysics, and evolutionary biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.