Recombinant Phenylobacterium zucineum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of YidC Function

YidC is a universally conserved bacterial membrane insertase critical for the co-translational integration of membrane proteins into the lipid bilayer . It operates via two pathways:

  • Sec-independent: Direct insertion of small, single-spanning membrane proteins (e.g., Pf3 coat, M13 procoat) through a hydrophilic groove formed by transmembrane helices (TM3 and TM5) .

  • SecYEG-coupled: Collaborative integration of multi-spanning proteins with the Sec translocon .

YidC's mechanism involves substrate recognition via charged residues (e.g., Arg72 in E. coli), hydrophobic interactions, and structural rearrangements to accommodate substrate insertion .

Recombinant YidC Production

Recombinant YidC from P. zucineum is likely produced using standard protocols for homologous proteins (e.g., E. coli, Francisella tularensis) :

ParameterDetails
Host SystemE. coli (common chassis for heterologous expression)
TagN-terminal His-tag for purification
Protein LengthFull-length (predicted 500–600 amino acids based on homologs)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; -80°C for stability

Research Applications

Recombinant YidC is typically used for:

  • Mechanistic Studies: Reconstitution in proteoliposomes to assay substrate insertion (e.g., Pf3 coat) .

  • Structural Biology: Cryo-EM or crystallography to determine insertion intermediates .

  • Interaction Mapping: Crosslinking or fluorescence assays to study SecYEG/YidC complexes .

Challenges and Knowledge Gaps

  • Species-Specific Variations: P. zucineum YidC may lack functional complementarity in E. coli due to N-AH sequence divergence .

  • Substrate Specificity: Unclear if P. zucineum YidC prioritizes pathogenicity-related membrane proteins, given the organism’s facultative intracellular lifestyle .

Comparative Data from Homologs

FeatureE. coli YidC F. tularensis YidC P. zucineum (Predicted)
Molecular Weight~60 kDa~61 kDa~60–62 kDa
Key InteractionSecYEG, ribosomeUnknownLikely SecYEG
Substrate ExamplePf3 coat, F0cUncharacterizedHypothetical pathogenicity factors

Future Directions

  • Functional Reconstitution: Test insertion activity using model substrates (e.g., Pf3 coat) .

  • Cryo-EM Studies: Resolve substrate-YidC interactions at the membrane interface .

  • Pathogenicity Links: Investigate YidC’s role in P. zucineum’s intracellular survival .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; PHZ_c0390; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Phenylobacterium zucineum (strain HLK1)
Target Names
yidC
Target Protein Sequence
MRDDNTRNTIIFFVCAALLLVLYQVFVIGPADKRRQAELARQAPPAAAAQAGQAGAPAAP QVPQAMTRQAAVAATPRVKIDTPMLTGSLSLRGARIDDLYLDRFRQTVEKDSPPVELLRP EGAQYPWFAEVGWVGANVPGLPDSGAVWTLAQGSTLAPGQPVVLTYANGQGLTFTRRIEV DDRYLFTITDTVANTTGQPVTIAPYGTVQRQGVPADLGKNQIVHEGAIGWLDGKLRQVKY GKWRKEGGGPAYNSTGGWLGITDKYWLAALIPGQQEAVTGQFRRTQAPGVDVLDANFVGA PVTIPAGRQVSETTRFFAGAKQVPILRDYEQSLGVAHFDNAVDWGNFWFLTRPIFQFLEF IHRYIGTFGLAILALTVVVRLIFFPLANKQYESITKMKKVQPQMEELRKKYKDDPAKQQQ ELLALYQREKVNPLAGCLPLLLQIPVFYALYKVLTVTIEMRHAPFMGWIQDLSARDPTTI WNLFGLIPWDPASAPLIGAFLNGPLHLGVLPILYGFTMWLTMAMSPPAGDPIQQKIFQLM PIIFTFIMAPFAVGLLIYWTWSNVLTLLQQYVIMRRFKVDNPIDQIIRKLTGKPKPAG
Uniprot No.

Target Background

Function
YidC is essential for the insertion and proper folding of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as certain lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in membrane protein biogenesis?

YidC serves as a membrane protein insertase that facilitates the integration of proteins into the lipid bilayer. In bacterial systems, YidC functions through two primary pathways: Sec-dependent and Sec-independent. For Sec-dependent substrates, YidC assists in the partitioning of nascent transmembrane segments from the SecY channel into the lipid bilayer and facilitates the proper bundling of these transmembrane segments . It positions itself at the lateral gate of SecY, which serves as the exit site for transmembrane segments from the translocation channel .

In the Sec-independent pathway, YidC can directly mediate the insertion of certain membrane proteins without requiring the Sec translocon. Genome-wide studies in Escherichia coli suggest that approximately 17-32% of cytoplasmic membrane proteins depend on YidC for proper biogenesis . In P. zucineum, YidC would be expected to perform similar functions, though species-specific substrates may vary.

How are YidC homologs structurally organized across different bacterial species?

YidC homologs across bacterial species share a conserved core structure consisting of a characteristic three-transmembrane helix (TMH) motif that buries a hydrophilic patch inside the membrane . This structural arrangement creates a hydrophilic groove that is open to the cytosol and penetrates partially into the membrane .

The core structure of YidC includes:

Structural FeatureFunctionConservation
Hydrophilic grooveFacilitates membrane protein insertion by exposing hydrophilic groups to the membraneHighly conserved
Three-TMH motifForms the structural foundation of the insertaseConserved across domains and species
First periplasmic loopInteracts with SecFVariable length but functional conservation
Transmembrane helicesMediate interactions with Sec apparatusKey residues highly conserved

While the core functional domains are conserved, there are species-specific variations in the N-terminal and periplasmic regions. P. zucineum YidC would be expected to maintain the conserved core structure while potentially displaying unique features in its variable regions .

How can heterologous expression systems be optimized for recombinant P. zucineum YidC production?

Optimizing heterologous expression of P. zucineum YidC requires addressing several methodological considerations:

  • Vector selection: For functional studies in E. coli, low-copy vectors like pACYC184 are preferable as they provide moderate expression levels that avoid toxicity issues. These vectors should contain appropriate antibiotic resistance markers for selection (chloramphenicol or kanamycin) .

  • Promoter selection: Expression can be driven by:

    • Native P. zucineum promoter if it functions in the host organism

    • Constitutive promoters for steady expression

    • Inducible promoters (like PBAD or IPTG-inducible systems) for controlled expression

  • Expression verification protocols:

    • SDS-PAGE and Western blotting to confirm expression

    • Functional complementation assays in YidC-depleted strains to verify activity

    • Membrane fractionation to confirm proper localization

  • Codon optimization: Adapt the P. zucineum yidC sequence to match the codon usage preferences of the expression host to enhance translation efficiency.

When using E. coli as an expression host, include proper signal sequences and membrane-targeting elements to ensure correct membrane insertion of the recombinant protein .

What methodologies can reveal the molecular mechanism of YidC-mediated membrane protein insertion?

Understanding the molecular mechanism of YidC-mediated membrane protein insertion requires a combination of structural, biochemical, and biophysical approaches:

MethodologyApplicationInformation Obtained
Cryo-electron microscopyStructural analysis of YidC-substrate complexesHigh-resolution structural details of insertion intermediates
Site-specific crosslinkingMapping interaction sitesIdentification of contact points between YidC and substrate proteins
Molecular dynamics simulationsMembrane distortion analysisInsights into how YidC's hydrophilic groove affects local membrane properties
In vitro reconstitutionFunctional assaysMinimal requirements for YidC-mediated insertion
FRET-based approachesReal-time insertion monitoringKinetic parameters of the insertion process

The hydrophilic groove of YidC is particularly important for its function. This groove penetrates partially into the membrane, exposing hydrophilic groups to the hydrophobic environment . Biophysical studies and molecular dynamics simulations suggest that this exposure distorts and thins the membrane in its vicinity, potentially lowering the energy barrier for translocation of hydrophilic segments of substrate proteins .

For P. zucineum YidC, researchers should combine these approaches with comparative analyses to other well-studied YidC proteins to identify both conserved mechanisms and species-specific adaptations .

How does YidC dimerization contribute to its functional properties?

YidC dimerization represents an important aspect of its function that connects to its evolutionary relationship with SecY. Evidence suggests that YidC has a tendency to form dimers via interfaces that may resemble those used by SecY progenitors .

A model for investigating YidC dimerization includes:

  • Structural analysis: Cryo-EM and X-ray crystallography can reveal dimerization interfaces. The antiparallel homodimerization of YidC homologs is particularly significant as it can form a nearly continuous hydrophilic pore, mimicking a channel-like structure .

  • Functional implications: In the dimerized state, YidC's hydrophilic grooves from each monomer may juxtapose to form a more complete channel, similar to how the retrotranslocation machinery components Hrd1 and Der1 form a near-continuous pore through the ER membrane .

  • Evolutionary perspective: The ability of YidC to form antiparallel homodimers supports the hypothesis that SecY may have evolved from a YidC homolog that formed a channel by juxtaposing two hydrophilic grooves .

For P. zucineum YidC, researchers should investigate species-specific dimerization properties and determine how they affect substrate selectivity and insertion efficiency compared to other bacterial species .

What is the evolutionary relationship between YidC and SecY, and how can it inform functional studies?

The evolutionary relationship between YidC and SecY provides important insights into membrane protein insertion mechanisms. Structural analyses have revealed a striking similarity between the core three-transmembrane helix motif of YidC and conserved elements of SecY .

Key evidence supporting YidC as the evolutionary precursor to SecY includes:

  • Structural homology: Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY, with the same connectivity .

  • Functional similarity: Both proteins facilitate membrane protein integration by burying hydrophilic groups inside the membrane .

  • Channel formation mechanism: SecY can be viewed as having evolved from a dimeric YidC homolog through gene duplication and fusion. This explains the pseudo-symmetrical arrangement of SecY's N- and C-terminal halves .

  • Conservation of functional elements: The point where helices H4 and H5 meet in YidC forms the hydrophobic end of the hydrophilic groove. In SecY, the corresponding amino acids form the pore ring, which lies near the center of the membrane .

Methodologically, researchers can use this evolutionary relationship to:

  • Design chimeric proteins combining elements from YidC and SecY to understand functional transitions

  • Identify conserved residues that may be critical for insertion function

  • Develop targeted mutagenesis experiments based on evolutionarily conserved features

For P. zucineum YidC studies, this evolutionary perspective provides a framework for understanding how specific adaptations in this bacterial species may reflect specialized functional requirements .

How can synthetic lethality screens be optimized to identify functional residues in P. zucineum YidC?

Synthetic lethality screens represent a powerful approach for identifying functionally important residues in YidC. Based on methodologies used with E. coli YidC, the following optimized protocol could be applied to P. zucineum YidC:

  • Reporter strain development:

    • Construct a strain where both yidC and secDF are under conditional control

    • Include an unstable complementing plasmid (e.g., pRC7 derivative) carrying wild-type secDF with a colorimetric marker (like lacZ)

  • Validation approaches:

    • Complementation assays under various conditions

    • Site-directed mutagenesis to confirm the role of specific residues

    • Suppressor screens to identify interacting partners

    • Structural analysis of identified residues

This approach has successfully identified residues like G355 and M471 in E. coli YidC that mediate interactions with SecY, and similar methodologies could reveal functionally important residues specific to P. zucineum YidC .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.