Recombinant Phenylobacterium zucineum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

NuoK is a membrane-anchored subunit of the NDH-1 complex (Complex I), which plays a dual role in bacterial respiratory chains:

  • Electron Transfer: Facilitates NADH oxidation to quinone, transferring electrons through iron-sulfur clusters .

  • Proton Translocation: Contributes to the proton motive force (PMF), enabling ATP synthesis or other energy-dependent processes .

In Phenylobacterium zucineum, nuoK is part of a 14-subunit complex (nuoA–nuoN) encoded by a polycistronic operon . Comparative genomic analysis suggests functional conservation with Caulobacter crescentus, a model organism for bacterial cell cycle regulation .

Genomic and Evolutionary Context

The nuoK gene (PHZ_c1794) is located on the circular chromosome of P. zucineum HLK1ᵀ, alongside other NDH-1 subunits . Key genomic features include:

FeatureDescription
Genomic LocationChromosome (3,996,255 bp)
OrthologsClosest to Caulobacter crescentus (98% 16S rRNA similarity)
Regulatory ContextPart of the CtrA regulon, linked to cell cycle control
Evolutionary SignificanceRetained in ~52% of bacterial genomes, indicating conserved energy roles

While P. zucineum is a facultative intracellular bacterium, its NDH-1 complex likely supports aerobic respiration and redox balance during host association .

Research Applications and Experimental Insights

The recombinant nuoK protein serves as a tool for studying bacterial Complex I dynamics:

Functional Assays

Table 2: Genomic Context of nuoK in P. zucineum

FeatureDetails
Locus TagPHZ_c1794
Gene ClusternuoA–nuoN operon
DNA G+C Content71.2%
OrthologsCaulobacter crescentus CtrA regulon

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please contact us in advance for arrangements. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nuoK; PHZ_c1794; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Phenylobacterium zucineum (strain HLK1)
Target Names
nuoK
Target Protein Sequence
MTIGLAHYLAVAAILFTIGVFGIFVNRKNIIVILMSIELILLAVNINLVAFSVYLGDVVG QIFAMFVLTVAAAEAAVGLAILVTFFRNRGDISVDDASMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this specific species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phenylobacterium zucineum and what makes it unique among bacterial species?

Phenylobacterium zucineum is a facultative intracellular bacterial species first isolated from the human leukemia cell line K562. Unlike other members of the genus Phenylobacterium, which are primarily environmental bacteria, P. zucineum is the only species in the genus known to infect and survive in human cells. What makes this organism particularly distinctive is its ability to establish a stable parasitic association with host cells without causing overgrowth or disruption of the host, allowing for long-term maintenance of infected cell lines (over three years in laboratory settings) . P. zucineum is a rod-shaped Gram-negative bacterium measuring 0.3–0.5 × 0.5–2 μm in size and belongs to the family Caulobacteraceae .

What is NADH-quinone oxidoreductase (Complex I) and what is its significance in bacterial physiology?

NADH-quinone oxidoreductase, also known as Complex I, is a multisubunit integral membrane enzyme that catalyzes the reversible transfer of electrons from NADH to membrane-bound quinone, coupling this reaction to proton translocation across the membrane . This process contributes to the generation of a proton motive force (PMF) which can be used for ATP synthesis and other cellular processes. Complex I plays a central role in energy conservation in both bacteria and eukaryotes, providing approximately 40% of the PMF used for ATP synthesis in mitochondria . In bacteria, Complex I contributes to diverse physiological functions depending on the species, including aerobic and anaerobic respiration, redox balance maintenance, and in some photosynthetic bacteria, it can operate in reverse to provide reducing power for CO₂ fixation .

How is the nuoK subunit positioned within the structure of bacterial Complex I?

The nuoK subunit is one of the membrane-embedded components of the 14-subunit bacterial Complex I (encoded by genes nuoA through nuoN). Within the complex, nuoK is positioned in the membrane arm of the enzyme, which is responsible for proton translocation across the membrane . The membrane proteins (including nuoK) form the proton-pumping machinery that couples electron transfer to proton translocation. In most bacteria with Complex I, including P. zucineum, the genes encoding the complex are colocalized in the genome, suggesting they form part of a polycistronic operon similar to what is observed in Escherichia coli .

What genomic features of P. zucineum are relevant to researchers studying nuoK?

The complete genome of P. zucineum consists of a circular chromosome (3,996,255 bp) and a circular plasmid (382,976 bp), encoding 3,861 putative proteins . Comparative genomic analysis reveals that P. zucineum is phylogenetically closest to Caulobacter crescentus, a model organism for cell cycle research . The genes encoding Complex I (nuoA through nuoN, including nuoK) are likely located within the chromosomal DNA and organized in an operon structure as is typical for bacterial Complex I genes, with 86% of bacterial genomes showing colocalization of these genes . In P. zucineum, approximately 5.32% of chromosomal genes and 6.48% of plasmid genes are dedicated to energy production and conversion functions, which would include the Complex I components .

What approaches are most effective for recombinant expression of nuoK from P. zucineum?

For recombinant expression of membrane proteins like nuoK, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with tunable promoters (like pET systems) that allow control over expression levels, as membrane proteins can be toxic when overexpressed.

  • Host selection: E. coli C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression as they can better tolerate membrane protein overexpression.

  • Fusion tags: Consider C-terminal or N-terminal His-tags to facilitate purification, but ensure they don't interfere with membrane insertion.

  • Expression conditions:

    • Induce at lower temperatures (16-20°C)

    • Use lower inducer concentrations

    • Grow in rich media supplemented with glucose to reduce basal expression

  • Membrane fraction isolation: Use differential centrifugation followed by sucrose gradient purification to isolate membrane fractions containing the recombinant protein.

Expression should be validated through Western blotting targeting the fusion tag or using antibodies against nuoK directly.

How does the structure of nuoK contribute to proton translocation in Complex I?

The nuoK subunit is one of the core membrane subunits involved in the proton translocation machinery of Complex I. While the search results don't provide the specific structural details of P. zucineum nuoK, research on homologous proteins suggests that nuoK contains several transmembrane helices that contribute to forming the proton translocation pathway. These helices typically contain conserved charged residues (such as lysine, glutamate, or aspartate) that participate in proton transfer. The arrangement of these residues creates a pathway through which protons can move across the membrane, contributing to the generation of the proton motive force. The nuoK subunit works in concert with other membrane subunits (nuoA, nuoH, nuoJ, nuoL, nuoM, and nuoN) to form the complete proton translocation apparatus, with conformational changes in these subunits being driven by the electron transfer occurring in the peripheral arm of the complex.

What experimental approaches can determine the functional importance of specific residues in nuoK?

To determine the functional importance of specific residues in the nuoK subunit, researchers should consider the following methodological approaches:

  • Site-directed mutagenesis:

    • Target conserved charged residues likely involved in proton translocation

    • Create alanine substitutions or conservative substitutions

    • Generate a library of single and multiple mutations

  • Complementation assays:

    • Express mutant versions in nuoK-deficient strains

    • Measure restoration of Complex I activity and growth phenotypes

  • In vitro activity assays:

    • NADH:ubiquinone oxidoreductase activity measurements

    • Proton pumping assays using reconstituted proteoliposomes

    • Measurement of membrane potential using fluorescent dyes

  • Structural analysis:

    • Cryo-electron microscopy of purified Complex I with wild-type vs. mutant nuoK

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

  • Computational approaches:

    • Molecular dynamics simulations to model proton movement through the channel

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for proton transfer energetics

Data from these experiments can be organized in a table format as follows:

MutationNADH:UQ Activity (% of WT)Proton Pumping (% of WT)Growth PhenotypePredicted Structural Effect
K45A[experimental value][experimental value][observation][computational prediction]
E72Q[experimental value][experimental value][observation][computational prediction]
D103N[experimental value][experimental value][observation][computational prediction]

How does P. zucineum nuoK compare to homologous proteins in other bacterial species?

A comprehensive comparative analysis of P. zucineum nuoK with homologous proteins from other bacterial species would involve sequence alignment, phylogenetic analysis, and structural comparisons. While specific data for nuoK isn't provided in the search results, we can infer an approach based on comparative genomics principles:

  • Sequence conservation: Using multiple sequence alignment tools (MUSCLE, CLUSTAL), researchers should analyze conservation patterns across diverse bacterial phyla. Typically, membrane-bound subunits like nuoK show conservation in functional residues involved in proton translocation while allowing greater sequence diversity in other regions.

  • Phylogenetic distribution: Based on the search results, Complex I is widespread in bacteria (found in 52% of analyzed bacterial genomes) . The nuoK gene would follow this distribution pattern, with potential variations in certain bacterial lineages.

  • Structural motifs: Identify conserved structural motifs across species that are critical for function, particularly transmembrane helices and charged residues involved in proton transfer.

  • Evolutionary rate analysis: Compare the evolutionary rate of nuoK to other Complex I subunits to determine if it evolves more quickly or is under stronger selective pressure.

What can we learn from comparing Complex I composition across different bacterial physiological groups?

The physiological role of Complex I varies significantly across bacterial species with different energetic lifestyles . A comparative analysis reveals that:

  • Respiratory versatility: Different Complex I variants are associated with specific types of respiratory chains (aerobic vs. anaerobic) . For example, in E. coli, Complex I is not required for aerobic respiration but is essential for anaerobic fumarate respiration .

  • Reverse electron flow: In photosynthetic bacteria like Rhodobacter capsulatus, Complex I can operate in reverse, using the proton motive force to drive NADH synthesis from quinol, which prevents overreduction of the quinone pool and provides reducing equivalents for CO₂ fixation .

  • Complex I variants: The search results indicate there are five main classes of bacterial Complex I, each potentially adapted to different physiological roles . Researchers studying P. zucineum nuoK should determine which class its Complex I belongs to for proper functional contextualizing.

  • Redox balance: Complex I appears to play a critical role in maintaining cellular redox state by reoxidizing NADH produced from central metabolism across many bacterial species .

What are the optimal conditions for purifying functional recombinant P. zucineum nuoK protein?

Purification of membrane proteins like nuoK presents significant challenges. The following methodological approach is recommended:

  • Membrane protein extraction:

    • Use mild detergents (n-dodecyl-β-D-maltoside or digitonin) to solubilize membranes

    • Maintain a cold temperature (4°C) throughout purification

    • Include protease inhibitors to prevent degradation

  • Purification strategy:

    • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC)

    • Follow with size exclusion chromatography to ensure protein homogeneity

    • Consider ion exchange chromatography as an additional purification step

  • Detergent exchange:

    • During purification, test different detergents to identify optimal stability conditions

    • Consider amphipols or nanodiscs for downstream structural studies

  • Quality control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism spectroscopy to verify proper folding

    • Mass spectrometry to confirm protein integrity

The purification process should be optimized to maintain the native structure of nuoK, which is critical for functional studies. If the goal is to study nuoK within the context of the entire Complex I, co-expression of multiple Complex I subunits may be necessary.

How can researchers effectively measure the activity of recombinant nuoK in isolation versus within the Complex I assembly?

Measuring the activity of nuoK presents different challenges depending on whether it's studied in isolation or as part of the complete Complex I assembly:

  • Activity measurement within complete Complex I:

    • NADH:ubiquinone oxidoreductase activity assay: Monitor NADH oxidation spectrophotometrically by following decrease in absorbance at 340 nm

    • Proton pumping assay: Reconstitute purified Complex I into liposomes and measure pH changes or membrane potential

    • Oxygen consumption measurements using oxygen electrodes when coupled to the respiratory chain

  • Activity measurements for isolated nuoK:

    • Proton conductance assays in proteoliposomes containing reconstituted nuoK

    • Patch-clamp electrophysiology if nuoK can form channels in artificial membranes

    • Binding assays with other Complex I subunits to assess assembly potential

  • Complementation approaches:

    • Express P. zucineum nuoK in nuoK-deficient bacterial strains

    • Measure restoration of Complex I activity and growth phenotypes

    • Use site-directed mutagenesis to identify critical residues

  • Biophysical characterization:

    • Fluorescence resonance energy transfer (FRET) studies to measure conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

How might researchers investigate the potential role of P. zucineum nuoK in pathogenicity or host interactions?

P. zucineum presents a unique research opportunity as it's the only species in its genus known to infect human cells while establishing a stable association without disrupting host cell growth . To investigate potential roles of nuoK in host interactions:

  • Genetic knockout studies:

    • Generate nuoK-deficient P. zucineum strains

    • Assess ability to invade and persist in host cells compared to wild-type

    • Evaluate host cell response through transcriptomics and proteomics

  • Host-pathogen interaction studies:

    • Compare infection dynamics between wild-type and nuoK mutants

    • Assess intracellular redox state changes during infection

    • Examine energy metabolism adaptations in intracellular bacteria

  • Immune response characterization:

    • Determine if nuoK or Complex I components are recognized by host immune system

    • Analyze inflammatory responses to wild-type versus nuoK-deficient bacteria

  • Comparative virulence analysis:

    • Test whether nuoK mutations affect the stable host-microbe relationship

    • Determine if nuoK contributes to adaptation to the intracellular environment

What approaches can address the challenges of studying membrane proteins like nuoK in structural biology?

Membrane proteins like nuoK present significant challenges for structural biology. Researchers should consider these methodological approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Currently the method of choice for Complex I structural studies

    • Can resolve structures at near-atomic resolution

    • Benefits from studying the entire Complex I rather than isolated subunits

    • Sample preparation is critical: use detergent micelles, nanodiscs, or amphipols

  • X-ray crystallography challenges and solutions:

    • Crystallization of membrane proteins is difficult

    • Use fusion partners like T4 lysozyme to increase soluble surface area

    • Screen extensive crystallization conditions with automated systems

    • Consider lipidic cubic phase crystallization

  • NMR spectroscopy approaches:

    • Solution NMR for protein dynamics studies

    • Solid-state NMR for structural information in native-like lipid environments

    • Selective isotope labeling to focus on specific regions

  • Computational modeling:

    • Homology modeling based on related structures

    • Molecular dynamics simulations in explicit membrane environments

    • Integration of sparse experimental data with computational predictions

  • Hybrid approaches:

    • Integrate low-resolution cryo-EM maps with high-resolution structures of components

    • Cross-validate structural models using functional data

    • Use distance constraints from cross-linking mass spectrometry

What computational approaches can predict the impact of nuoK mutations on Complex I assembly and function?

Computational approaches for predicting the impact of nuoK mutations include:

  • Sequence-based prediction:

    • Conservation analysis across homologs to identify critical residues

    • Coevolution analysis to identify residues that interact functionally

    • Machine learning approaches trained on known membrane protein mutations

  • Structural prediction:

    • Homology modeling of P. zucineum nuoK based on related structures

    • Molecular dynamics simulations of wild-type and mutant proteins

    • Free energy calculations to assess stability changes upon mutation

  • Molecular simulation approaches:

    • All-atom simulations in explicit membrane to study proton pathways

    • Coarse-grained simulations to study larger-scale conformational changes

    • Quantum mechanical calculations for proton transfer energetics

  • Network analysis:

    • Protein-protein interaction networks to predict assembly defects

    • Metabolic control analysis to predict systemic effects of mutations

    • Flux balance analysis to predict growth phenotypes

  • Integration of experimental data:

    • Evolutionary coupling analysis validated by cross-linking data

    • Incorporation of hydrogen-deuterium exchange data to identify dynamic regions

    • Validation using site-directed mutagenesis experimental results

Computational MethodData RequirementsPrediction CapabilitiesLimitations
Homology modelingTemplate structure3D structure predictionAccuracy depends on template similarity
Molecular dynamics3D structureConformational dynamics, stabilityComputationally expensive
Conservation analysisMultiple sequence alignmentFunctional site predictionCannot predict novel function
Coevolution analysisLarge sequence datasetInteraction networks, contactsRequires diverse sequence data
Machine learningTraining data of known mutationsPhenotype predictionQuality depends on training data

What strategies can overcome expression and purification difficulties with recombinant nuoK?

Membrane proteins like nuoK present numerous expression and purification challenges. Here are methodological solutions:

  • Expression troubleshooting:

    • Problem: Toxic effects on host cells
      Solution: Use tightly controlled inducible promoters; start with lower inducer concentrations

    • Problem: Inclusion body formation
      Solution: Lower expression temperature (16-20°C); use specialized E. coli strains (C41/C43); co-express molecular chaperones

    • Problem: Poor membrane integration
      Solution: Use signal sequences optimized for membrane targeting; consider homologous expression systems

  • Solubilization optimization:

    • Systematic screening of detergents (start with milder detergents like DDM, LMNG)

    • Optimize detergent:protein ratios

    • Test detergent mixtures and novel solubilization agents (SMALPs, amphipols)

  • Purification enhancement:

    • Consider fusion tags beyond His-tags (Strep-tag II, FLAG-tag)

    • Use on-column detergent exchange during purification

    • Implement size exclusion chromatography as final polishing step

  • Stability improvements:

    • Add lipids during purification to maintain native-like environment

    • Screen buffer compositions systematically (pH, salt concentration, additives)

    • Use thermal shift assays to identify stabilizing conditions

How can researchers distinguish between direct effects of nuoK mutations and indirect effects on Complex I assembly?

Distinguishing direct functional effects from assembly defects is critical for interpreting nuoK mutation studies:

  • Assembly analysis methods:

    • Blue native PAGE to visualize intact Complex I assembly

    • Immunoprecipitation with antibodies against other Complex I subunits

    • Size exclusion chromatography to quantify assembled complex versus free subunits

    • Sucrose gradient centrifugation to separate assembled complexes

  • Localization studies:

    • Fluorescent protein fusions to track subcellular localization

    • Membrane fractionation followed by Western blotting

    • Protease protection assays to confirm proper membrane topology

  • Functional dissection approaches:

    • Compare NADH dehydrogenase activity (peripheral arm function) versus proton pumping (membrane arm function)

    • Measure electron transfer to artificial electron acceptors that bypass parts of the electron transport chain

    • Complementation with individual domains or chimeric proteins

  • Time-resolved assembly studies:

    • Pulse-chase experiments to track assembly intermediates

    • Inducible expression systems to monitor assembly kinetics

    • Temperature-sensitive mutants to trap assembly intermediates

What emerging technologies could advance our understanding of nuoK structure and function?

Several emerging technologies hold promise for advancing nuoK research:

  • Advanced structural biology approaches:

    • Microcrystal electron diffraction (MicroED) for membrane proteins resistant to traditional crystallization

    • Single-particle cryo-EM with improved detectors and processing algorithms

    • Integrative structural biology combining multiple experimental techniques with computational modeling

  • Genetic manipulation advances:

    • CRISPR-Cas9 genome editing in P. zucineum for precise chromosome modifications

    • Base editing technologies for introducing point mutations without double-strand breaks

    • Inducible degradation systems for temporal control of protein levels

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational changes during catalysis

    • Atomic force microscopy to study mechanical properties and interactions

    • Nanopore recording for single-molecule electrophysiology

  • Advanced imaging:

    • Super-resolution microscopy to visualize Complex I distribution in bacterial cells

    • Correlative light and electron microscopy to link function to ultrastructure

    • Cryo-electron tomography of intact bacterial cells to visualize Complex I in situ

  • Biophysical approaches:

    • Time-resolved spectroscopy to capture transient states during catalysis

    • Native mass spectrometry for intact membrane protein complexes

    • Hydrogen-deuterium exchange with mass spectrometry for dynamics and interactions

How might research on P. zucineum nuoK contribute to broader understanding of host-microbe interactions?

P. zucineum's unique ability to establish stable intracellular infections without disrupting host cell growth makes it a valuable model for studying host-microbe interactions:

  • Host adaptation mechanisms:

    • Investigate whether Complex I components like nuoK are modified during intracellular growth

    • Determine if energy metabolism shifts when P. zucineum transitions to intracellular lifestyle

    • Compare gene expression profiles between free-living and intracellular bacteria

  • Bacterial persistence strategies:

    • Explore whether nuoK mutations affect long-term intracellular survival

    • Investigate if Complex I activity modulates interactions with host defense mechanisms

    • Study potential metabolic adaptations that support non-disruptive intracellular growth

  • Evolutionary perspectives:

    • Compare P. zucineum Complex I with those of related environmental Phenylobacterium species

    • Investigate whether specific adaptations in energy metabolism genes correlate with the ability to infect human cells

    • Study horizontal gene transfer events that might have contributed to host-adaptation capabilities

  • Therapeutic implications:

    • Evaluate whether targeting bacterial Complex I could disrupt intracellular persistence

    • Investigate if P. zucineum interactions with host cells could inform development of bacterial vectors for therapeutic applications

    • Study potential immunomodulatory effects of persistent intracellular bacteria on host cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.