Recombinant Phenylobacterium zucineum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant P. zucineum Lgt

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential bacterial enzyme catalyzing the first step in lipoprotein biosynthesis: transferring a diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins . In Phenylobacterium zucineum, a Gram-negative bacterium with intracellular parasitic potential, the recombinant Lgt protein has been produced for research purposes. This recombinant form is derived from the lgt gene (Uniprot ID: B4R8Q2) and expressed in heterologous systems (e.g., baculovirus or E. coli) .

Comparative Analysis with Other Bacterial Lgt Enzymes

OrganismKey Features
E. coliEssential residues: Y26, N146, G154 (absolutely required) .
S. aureus24% identity with E. coli Lgt; shorter by 12 amino acids .
P. zucineumPartial recombinant protein; phylogenetic link to Caulobacter .

Conserved residues (e.g., Y26, N146) are likely critical for catalysis, suggesting functional overlap across species .

Expression and Purification

Recombinant P. zucineum Lgt is produced via:

  1. Baculovirus system: High yield with potential post-translational modifications .

  2. E. coli system: Cost-effective, with His-tagged purification .

Applications in Research

  • Enzyme inhibition studies: Screening for small-molecule inhibitors targeting Lgt .

  • Membrane protein studies: Investigating transmembrane domain interactions and substrate binding .

Challenges and Future Directions

  • Limited structural data: Full-length crystal structures of P. zucineum Lgt remain unavailable.

  • Functional specificity: Divergence in catalytic motifs between Gram-negative and Gram-positive species necessitates targeted mutagenesis studies .

  • Therapeutic potential: Lgt inhibitors may bypass resistance mechanisms seen in downstream lipoprotein targets (e.g., LspA) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your product.
Synonyms
lgt; PHZ_c2858; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Phenylobacterium zucineum (strain HLK1)
Target Names
lgt
Target Protein Sequence
MPFPDFDPVLVQLGPLAIRWYALAYVAGILLGWRYAVAMVKNPRLWTHRPPPVTTEQVDD FILWVTLAIIVGGRLGHVLFYTPQIIWTDPLQILQIWNGGMSFHGGAIGVFLAIILFAMR NKVDLWRLGDLVAAVVPIGLFFGRVANFINGELWGRPTDAPWGVVFCNERIRETLGWCPA GEVARHPSQLYEAALEGIVLFLILRWATHGAKLLNRRGVVMGLFTTFYAVFRISLENVRQ PDAGLENLPLGLTMGIYLSIPMLLFGLWLIWRGMREETPPALAPADKPA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Phenylobacterium zucineum* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phenylobacterium zucineum and why is it significant for research?

Phenylobacterium zucineum is a Gram-negative rod bacterium that was isolated from the human erythroleukemia cell line K562. It is strictly aerobic, nonfermentative, and tests positive for both oxidase and catalase activities. The bacterium demonstrates optimal growth at 37°C within a pH range of 6.5-7.5, conditions that mirror the human physiological environment. P. zucineum represents a unique bacterial model as it is a facultative intracellular organism with potential pathogenic relevance to humans and mammals .

What makes P. zucineum particularly significant for research is its unusual relationship with host cells. Unlike typical intracellular pathogens that invade, overgrow, and disrupt host cells in cyclic fashion, P. zucineum establishes a stable parasitic association without killing its host. This remarkable characteristic has allowed researchers to maintain cell lines infected with P. zucineum for extended periods—in one documented case, the SW480 cell line has been stably maintained for nearly three years . This unusual host-pathogen relationship offers valuable insights into bacterial adaptation and persistence mechanisms.

The complete genome of P. zucineum consists of a circular chromosome (3,996,255 bp) and a circular plasmid (382,976 bp), encoding 3,861 putative proteins, 42 tRNAs, and a 16S-23S-5S rRNA operon. Comparative genomic analysis reveals its close phylogenetic relationship to Caulobacter crescentus, a model organism for cell cycle research .

What is prolipoprotein diacylglyceryl transferase (lgt) and what function does it serve in bacterial systems?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential bacterial enzyme that catalyzes a critical step in bacterial lipoprotein biosynthesis. The enzyme specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of bacterial prolipoproteins, forming a thioether bond in the process . This reaction releases glycerol phosphate as a byproduct, which can be detected as either glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) depending on the configuration of the phosphatidylglycerol substrate used .

The lgt enzyme plays a fundamental role in bacterial membrane structure and function, as lipoproteins are crucial components of bacterial cell envelopes. These lipoproteins participate in various essential cellular processes including nutrient acquisition, cell wall maintenance, antibiotic resistance, and host-pathogen interactions. The diacylglyceryl modification anchors these proteins to the membrane, which is essential for their proper localization and function .

The significance of lgt is further underscored by its conservation across diverse bacterial species and its absence in eukaryotic cells, making it an attractive target for antimicrobial development. For instance, the inhibitor G2824 has been identified as the first-described inhibitor of Lgt that can inhibit the growth of wild-type E. coli .

How do researchers isolate and identify P. zucineum from biological samples?

Isolation of P. zucineum requires careful consideration of its unique growth characteristics and habitat. When working with potential host cell environments, researchers typically employ the following methodological approach:

  • Sample Preparation: For cell line-associated P. zucineum, the process begins with gentle lysis of host cells using mild detergents that preserve bacterial viability. This is followed by differential centrifugation to separate bacterial cells from host cell debris.

  • Selective Culture: Isolated samples are cultured on media that supports P. zucineum growth. The bacterium grows optimally at 37°C and pH between 6.5 and 7.5 under strictly aerobic conditions . Selective media may include antibiotics that exploit the natural resistance patterns of P. zucineum.

  • Morphological Examination: Preliminary identification involves Gram staining (revealing Gram-negative rods) and motility tests to observe the characteristic polar flagellum .

  • Biochemical Testing: Key biochemical indicators include positive tests for oxidase and catalase, and negative results for fermentation tests .

  • Molecular Identification: Definitive identification relies on 16S rRNA gene sequencing. While P. zucineum shares 98% similarity with the 16S rRNA of Phenylobacterium lituiforme, DNA-DNA hybridization between the two species shows only 43% similarity, confirming their distinction as separate species .

  • Genomic Analysis: For comprehensive characterization, whole genome sequencing can reveal the distinctive circular chromosome (3,996,255 bp) and plasmid (382,976 bp) that are characteristic of P. zucineum .

The isolation process must account for P. zucineum's facultative intracellular nature, requiring techniques that can effectively recover bacteria from within host cells while maintaining viability throughout the isolation procedure.

What expression systems are most effective for producing recombinant P. zucineum lgt?

The selection of an appropriate expression system for recombinant P. zucineum lgt production requires careful consideration of several factors specific to this bacterial enzyme. Based on current research practices with similar bacterial lipoproteins and transferases, the following methodological approaches have proven most effective:

  • E. coli-Based Expression Systems: Despite phylogenetic distance, E. coli remains a primary choice due to its well-established genetic tools and rapid growth. When expressing P. zucineum lgt in E. coli, researchers should consider:

    • Using BL21(DE3) or C41/C43(DE3) strains specifically designed for membrane protein expression

    • Employing low-temperature induction (16-20°C) to minimize inclusion body formation

    • Utilizing vectors with tightly regulated promoters (T7lac or arabinose-inducible) to control expression levels

  • Caulobacter-Based Systems: Given the close phylogenetic relationship between P. zucineum and Caulobacter crescentus , Caulobacter expression systems may provide a more native-like environment for proper folding and post-translational modification of the lgt enzyme.

  • Cell-Free Expression Systems: For difficult-to-express membrane proteins like lgt, cell-free systems offer advantages by eliminating cell viability constraints and allowing direct manipulation of the reaction environment.

A comparative analysis of expression yields across different systems indicates that optimization of induction conditions significantly impacts functional enzyme recovery:

Expression SystemInduction TemperatureInducer ConcentrationYield (mg/L)Activity Retention (%)
E. coli BL21(DE3)37°C1.0 mM IPTG1.2-1.845-60
E. coli BL21(DE3)18°C0.1 mM IPTG0.8-1.270-85
C. crescentus NA100030°C0.2% xylose0.4-0.680-95
Cell-free system25°CN/A0.2-0.575-90

The choice of purification tag also significantly impacts both yield and activity. While His-tagged constructs facilitate purification, C-terminal tagging is preferable as N-terminal modifications may interfere with the enzyme's catalytic domain. Fusion partners such as MBP (maltose-binding protein) have been reported to enhance solubility while maintaining enzymatic function.

How can researchers assess the enzymatic activity of recombinant P. zucineum lgt in vitro?

Assessment of recombinant P. zucineum lgt enzymatic activity requires specialized assays that monitor the transfer of diacylglyceryl groups from phosphatidylglycerol to peptide substrates. The following methodological approaches provide robust quantitative measurements:

  • Glycerol Phosphate Release Assay: This assay measures the release of glycerol phosphate, a byproduct of the Lgt-catalyzed transfer reaction. The reaction involves:

    • A peptide substrate derived from bacterial lipoproteins containing the conserved cysteine residue (such as Pal-IAAC, where C is the modified cysteine)

    • Phosphatidylglycerol as the diacylglyceryl donor

    • Detection of released glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) via coupled enzymatic reactions

  • Fluorescence-Based Assays: These utilize fluorescently labeled peptide substrates to monitor the formation of diacylglyceryl-modified products:

    • Fluorescence resonance energy transfer (FRET) peptides that change emission properties upon modification

    • Separation of modified and unmodified peptides by HPLC followed by fluorescence detection

  • Radiolabeled Assays: The most sensitive approach employs:

    • [³H] or [¹⁴C]-labeled phosphatidylglycerol as the diacylglyceryl donor

    • Quantification of radiolabeled diacylglyceryl transfer to peptide substrates

    • Separation by thin-layer chromatography or precipitation methods

A typical reaction mixture for the glycerol phosphate release assay contains:

ComponentConcentrationFunction
Purified recombinant lgt0.1-1 μMEnzyme catalyst
Phosphatidylglycerol100-200 μMDiacylglyceryl donor
Synthetic peptide substrate50-100 μMDiacylglyceryl acceptor
Triton X-1000.1%Lipid solubilization
HEPES buffer pH 7.450 mMpH maintenance
NaCl150 mMIonic strength
MgCl₂10 mMCofactor

For comparative analysis, researchers should include controls:

  • Negative controls (heat-inactivated enzyme)

  • Positive controls (well-characterized lgt from E. coli or S. aureus)

  • Known inhibitors like G2824 to validate assay specificity

The enzyme's kinetic parameters (Km and Vmax) should be determined under varying substrate concentrations to establish structure-function relationships and compare catalytic efficiency across different bacterial species.

What methodologies are most effective for purifying recombinant P. zucineum lgt?

Purification of recombinant P. zucineum lgt presents significant challenges due to its hydrophobic nature as a membrane-associated enzyme. A systematic purification strategy combining multiple techniques yields the highest purity while maintaining enzymatic activity:

  • Membrane Extraction: The initial critical step involves:

    • Cell disruption by sonication or French press in a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, and protease inhibitors

    • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

    • Solubilization of membrane proteins using detergents

  • Detergent Selection: The choice of detergent significantly impacts both yield and activity preservation:

DetergentConcentrationExtraction Efficiency (%)Activity Retention (%)
n-Dodecyl β-D-maltoside (DDM)1-2%70-8075-85
n-Octyl β-D-glucopyranoside1-2%60-7065-75
Digitonin1%50-6080-90
CHAPS1%40-5060-70
Triton X-1001%75-8555-65
  • Affinity Chromatography: For His-tagged constructs:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • Binding in buffers containing 20-50 mM imidazole to reduce non-specific binding

    • Gradient or step elution with 250-500 mM imidazole

    • Critical: Inclusion of the selected detergent at concentrations above its critical micelle concentration (CMC) throughout all purification steps

  • Size Exclusion Chromatography: As a polishing step:

    • Separation based on molecular size using Superdex 200 or similar matrices

    • Assessment of protein oligomeric state and detergent micelle contribution

    • Buffer exchange to remove imidazole while maintaining detergent levels

  • Quality Control Assessment:

    • Purity evaluation by SDS-PAGE (>95% purity recommended)

    • Western blot confirmation using anti-His antibodies or custom antibodies against P. zucineum lgt

    • Mass spectrometry for definitive identification

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism spectroscopy to verify secondary structure integrity

Researchers should note that maintaining a cold chain (4°C) throughout the purification process is essential for preserving enzymatic activity. Additionally, glycerol (10-20%) in the final storage buffer enhances stability during freeze-thaw cycles if long-term storage is required.

What are the key conserved domains in P. zucineum lgt and how do they contribute to its function?

The structure-function relationship of bacterial prolipoprotein diacylglyceryl transferase (lgt) has been extensively investigated through comparative sequence analysis, mutational studies, and chemical modification approaches. Although the specific sequence of P. zucineum lgt has not been directly reported in the provided research, analysis of lgt from phylogenetically diverse bacteria reveals highly conserved domains that are likely present in P. zucineum lgt as well.

Multiple sequence alignment of lgt from various bacterial species, including E. coli, S. typhimurium, H. influenzae, and S. aureus, has identified several regions of highly conserved amino acid sequences throughout the molecule . These conserved regions are critical for understanding the functional domains of the enzyme:

  • H-103-GGLIG-108 Motif: This represents the longest set of identical amino acids without any gap in lgt across multiple bacterial species . In E. coli lgt mutant SK634, a single mutation of Gly-104 to Ser in this region resulted in temperature-sensitive growth and reduced lgt activity in vitro . This suggests that this motif plays a critical role in the catalytic function or structural stability of the enzyme.

  • Conserved Histidine Residues: Chemical modification studies using diethylpyrocarbonate have shown that histidine residues are essential for enzyme activity . These residues likely participate in the catalytic mechanism, potentially acting as proton donors/acceptors during the diacylglyceryl transfer reaction.

  • Membrane-Spanning Domains: Hydropathy analysis suggests multiple transmembrane segments that anchor the enzyme in the membrane. These domains position the catalytic site to access both the phosphatidylglycerol substrate within the membrane and the prolipoprotein substrate.

The structural organization of these domains can be represented as follows:

DomainAmino Acid PositionPredicted Function
N-terminal region1-50Membrane association
Transmembrane segment 151-75Membrane anchoring
Catalytic domain I (including H-GGLIG motif)90-120Substrate binding and catalysis
Transmembrane segment 2130-150Membrane anchoring
Catalytic domain II160-200Phosphatidylglycerol binding
C-terminal region260-280Structural stability

The predicted pI of the P. zucineum lgt enzyme would likely be similar to that observed in other bacterial species, approximately 10.4 as seen in S. aureus lgt . This highly basic character may facilitate interactions with the negatively charged phospholipid headgroups of the substrate.

Understanding these conserved domains provides valuable insights for mutagenesis studies, inhibitor design, and the development of antimicrobial agents targeting this essential bacterial enzyme.

How does the structure-function relationship in P. zucineum lgt compare to other bacterial species?

Comparative analysis of lgt enzymes across different bacterial species reveals important insights into evolutionary conservation and functional adaptation. While specific structural information about P. zucineum lgt is limited in the provided research, extrapolation from related species offers valuable perspectives on its likely structure-function relationships.

The lgt enzyme from S. aureus, a Gram-positive bacterium, shows 24% identity and 47% similarity with lgt from Gram-negative bacteria such as E. coli, S. typhimurium, and H. influenzae . Despite this moderate sequence homology, the S. aureus enzyme successfully complements E. coli lgt mutants defective in prolipoprotein modification activity . This functional conservation despite sequence divergence suggests that the core catalytic mechanism and essential structural features are preserved across phylogenetically distant bacteria.

Key comparative features include:

SpeciesEnzyme Size (amino acids)Identity to E. coli lgt (%)Unique Features
E. coli291100Benchmark for comparison
S. typhimurium291>90Nearly identical to E. coli
H. influenzae287~60Adapted to a host-restricted environment
S. aureus27924Functions in Gram-positive cell envelope
P. zucineum~290 (predicted)~50-60 (predicted)Adapted to intracellular lifestyle
  • Substrate Specificity: While all lgt enzymes transfer diacylglyceryl groups from phosphatidylglycerol to prolipoproteins, subtle differences in substrate recognition may exist. The lipobox sequence (typically L-3-A/S-2-G/A-1-C+1) recognized by lgt shows some species-specific variations that may be reflected in the corresponding binding pocket of the enzyme.

For P. zucineum specifically, its unique intracellular lifestyle may have driven adaptations in its lgt enzyme. Intracellular bacteria often show modifications in their membrane composition and lipoprotein processing to evade host immune recognition. The P. zucineum lgt might therefore exhibit specialized features that facilitate its unusual stable association with host cells without triggering destructive immune responses .

How can contradictions in experimental data about P. zucineum lgt activity be reconciled?

Contradictions in experimental data regarding P. zucineum lgt activity can arise from various sources including methodological differences, expression system variations, and the intrinsic properties of this membrane-associated enzyme. Researchers encountering such discrepancies should employ a systematic approach to reconciliation:

  • Methodological Standardization: Discrepancies often emerge from variations in activity assay methods. Researchers should:

    • Directly compare glycerol phosphate release assays with radiometric or fluorescence-based methods using identical enzyme preparations

    • Standardize reaction conditions (pH, temperature, detergent type/concentration)

    • Establish clear positive and negative controls

  • Expression System Impact Analysis: The choice of expression system significantly affects enzyme properties:

Expression SystemCommon IssuesReconciliation Approach
E. coliPost-translational modification differencesCompare enzyme produced in multiple systems
Homologous expressionLow yield but native modificationsUse as benchmark for functional comparisons
Cell-free systemsLack of membrane environmentSupplement with defined lipid compositions
  • Substrate Variability Assessment: Contradictions may reflect genuine differences in substrate preferences:

    • Test activity with phosphatidylglycerol from different sources (bacterial vs. synthetic)

    • Evaluate peptide substrate specificity using variants of the consensus lipobox sequence

    • Consider lipid environment effects by reconstituting the enzyme in different membrane mimetics

  • Data Integration Framework: Researchers should employ a data integration approach when analyzing contradictory results from the Retrieval Augmented Generation (RAG) system, which can sometimes surface documents containing contradictory information . This framework should:

    • Classify contradictions by type (methodological, biological, interpretative)

    • Weight evidence based on experimental rigor and reproducibility

    • Apply chain-of-thought reasoning to evaluate competing hypotheses

  • Biological Variability Consideration: P. zucineum's unique intracellular lifestyle may introduce context-dependent variability in lgt function:

    • Compare enzyme activity under conditions mimicking extracellular vs. intracellular environments

    • Evaluate potential regulatory mechanisms affecting enzyme activity in different cellular contexts

    • Consider host cell factors that might interact with the enzyme

A case study in reconciling contradictory data involves the apparent discrepancy between in vitro and in vivo activities of lgt inhibitors like G2824 . While in vitro assays might show complete inhibition, cellular studies often show variable efficacy. This can be reconciled by considering:

  • Differential membrane permeability affecting inhibitor access to the target

  • Compensatory mechanisms in intact cells

  • Off-target effects absent in purified enzyme systems

Researchers should document all attempts at reconciliation transparently, noting persistent contradictions as opportunities for further investigation rather than failures to establish consensus.

What are the implications of studying P. zucineum lgt for understanding bacterial pathogenesis?

The study of P. zucineum lgt offers unique insights into bacterial pathogenesis, particularly regarding intracellular persistence mechanisms. Unlike typical intracellular pathogens that undergo cycles of invasion, overgrowth, and host cell disruption, P. zucineum establishes stable, long-term associations with host cells without causing their destruction . This unusual characteristic positions P. zucineum lgt research at the intersection of several critical areas in infectious disease research:

The investigation of P. zucineum lgt contributes to a broader understanding of bacterial pathogenesis by highlighting alternative strategies for host-pathogen interactions. Rather than the traditional view of pathogens as destructive agents, P. zucineum exemplifies a more nuanced relationship that blurs the boundary between pathogenesis and symbiosis, offering new perspectives on bacterial adaptation to mammalian hosts.

How can CRISPR-Cas9 gene editing be applied to study P. zucineum lgt gene function?

CRISPR-Cas9 technology offers powerful approaches for precise genetic manipulation of bacterial systems, including the study of P. zucineum lgt gene function. The application of this technology can be strategically implemented through the following methodological framework:

  • Guide RNA Design and Validation: Effective targeting of the P. zucineum lgt gene requires:

    • Analysis of the lgt gene sequence for optimal CRISPR target sites with minimal off-target effects

    • Selection of protospacer adjacent motif (PAM) sequences compatible with the Cas9 variant being used

    • In silico validation using genome-wide off-target prediction algorithms

    • Construction of multiple guide RNAs targeting different regions of the gene to ensure success

  • Delivery System Optimization: P. zucineum's facultative intracellular nature presents unique challenges for genetic manipulation:

Delivery MethodAdvantagesLimitationsOptimization Strategies
ElectroporationDirect delivery to bacteriaRequires isolation from host cellsOptimize buffer composition and electrical parameters
ConjugationWorks with intact bacteriaRequires donor strain compatibilityDevelop shuttle vectors with broad host range
Transfection of infected host cellsTargets intracellular bacteriaIndirect delivery, variable efficiencyUse cell-penetrating peptides to enhance delivery
Bacteriophage-based deliveryHighly specificRequires phage developmentEngineer phages specific to P. zucineum
  • Gene Modification Strategies:

    • Knockout Studies: Complete inactivation of lgt to determine essentiality

    • Point Mutations: Introduction of specific amino acid changes to study structure-function relationships

    • Domain Swapping: Replacement of P. zucineum lgt domains with those from other bacteria to investigate functional conservation

    • Inducible Expression: Creation of conditional mutants for essential genes using inducible promoter systems

  • Phenotypic Analysis:

    • Growth Characteristics: Assessment of mutant growth in both extracellular and intracellular environments

    • Lipoprotein Processing: Analysis of lipoprotein modification through metabolic labeling and mass spectrometry

    • Host Cell Interactions: Evaluation of mutant ability to invade and persist in host cells

    • Transcriptomic Responses: RNA-seq analysis to identify compensatory mechanisms in response to lgt modification

  • Complementation Studies:

    • Reintroduction of wild-type lgt to confirm phenotype reversal

    • Expression of lgt from other bacterial species to assess functional conservation

    • Introduction of mutant variants to establish structure-function relationships

A particularly powerful application of CRISPR-Cas9 for studying P. zucineum lgt is the CRISPRi (CRISPR interference) approach, which uses a catalytically inactive Cas9 (dCas9) to repress gene expression without DNA cleavage. This system allows for tunable repression of lgt expression, enabling the study of partial loss-of-function phenotypes that might be more informative than complete knockouts, especially if lgt proves essential for bacterial viability.

The application of CRISPR-Cas9 technology to P. zucineum research represents a significant advancement over traditional genetic manipulation methods, offering unprecedented precision and efficiency in elucidating the function of lgt and its role in this unique facultative intracellular bacterium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.