Recombinant Phenylobacterium zucineum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; PHZ_c1266; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Phenylobacterium zucineum (strain HLK1)
Target Names
crcB
Target Protein Sequence
MQALLLVGAGGAAGAVARYLLGVQALRWLGPGWPYGTFAANILGGFLMGLLAGGLAHRGG AGQETWRLLLGVGALGGFTTFSAYSLEVALMIERRAYGQAFAYSLGSVALAVAALFAGLL LARRVFA
Uniprot No.

Target Background

Function

Important Function: CrcB homolog reduces intracellular fluoride concentration, mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phenylobacterium zucineum and what makes it unique in microbiology?

Phenylobacterium zucineum is a facultative intracellular bacterium that was first isolated from the human leukemia cell line K562. Unlike typical intracellular pathogens that cause host cell disruption, P. zucineum maintains a stable association with its host cell without affecting the growth and morphology of the latter. This unique characteristic allows P. zucineum to establish long-term parasitic relationships with human cells, with infected cell lines being maintained in laboratory conditions for up to three years without significant host cell disruption .

The bacterium is rod-shaped, Gram-negative, and measures approximately 0.3–0.5 × 0.5–2 μm in size. P. zucineum belongs to the genus Phenylobacterium, which currently comprises five species, with P. zucineum being the only known species in this genus capable of infecting and surviving in human cells .

How does P. zucineum compare with other intracellular bacteria in terms of host interactions?

P. zucineum demonstrates a unique pattern of host interaction compared to other intracellular bacteria. While many intracellular pathogens like Salmonella, Shigella, or Mycobacterium species typically undergo cycles of invasion, replication, host cell lysis, and re-infection, P. zucineum establishes a stable, long-term association with host cells.

The relationship appears to be parasitic yet non-destructive, as P. zucineum does not overgrow intracellularly to kill the host. Furthermore, when host cells divide, they carry the bacteria to their progeny cells. For example, the SW480 cell line infected with P. zucineum has been stably maintained for nearly three years in laboratory settings without significant host cell disruption or death .

This stable association pattern differs fundamentally from the typical pathogenic cycle of most known intracellular bacteria, suggesting P. zucineum may employ unique molecular mechanisms to modulate host cell responses and establish persistent infections.

What are the key features of the P. zucineum genome, particularly in relation to the crcB gene?

The genome of Phenylobacterium zucineum strain HLK1T consists of a circular chromosome (3,996,255 bp) and a circular plasmid (382,976 bp). The genome has a high GC content, with 71.35% for the chromosome and 68.54% for the plasmid. It encodes 3,861 putative proteins (3,534 on the chromosome and 327 on the plasmid), along with 42 tRNAs and a 16S-23S-5S rRNA operon .

The crcB gene (locus identifier: PHZ_c1266) is located on the chromosome and encodes the 127-amino-acid CrcB homolog protein. The gene is part of the 88.85% of the chromosomal DNA that constitutes the coding region of the genome .

The genome contains several families of protein-coding repetitive sequences and a family of noncoding repeats, with some identical copies found in both the chromosome and plasmid, suggesting potential involvement in homologous recombination events .

How is P. zucineum phylogenetically related to other bacterial species, and what implications does this have for crcB homolog research?

Comparative genomic analysis reveals that P. zucineum is phylogenetically closest to Caulobacter crescentus, a model species extensively used for cell cycle research. Notably, P. zucineum possesses a gene that is strikingly similar in both structure and function to the cell cycle master regulator CtrA of C. crescentus. Furthermore, most genes directly regulated by CtrA in C. crescentus have orthologs in P. zucineum, suggesting a well-conserved CtrA regulon between these species .

For crcB homolog research, this phylogenetic relationship provides an important comparative framework. Researchers can leverage the extensive knowledge about C. crescentus gene regulation and cell cycle control to inform studies on P. zucineum's crcB homolog. Additionally, comparing the crcB homolog between these related species may provide insights into functional conservation or divergence that could illuminate the protein's role in bacterial physiology or host interactions.

What computational methods are recommended for identifying crcB homologs across different bacterial species?

To identify crcB homologs across different bacterial species, researchers should employ a systematic approach using various bioinformatics tools and databases:

  • Starting with a gene name approach: Search the HomoloGene database with the gene name "crcB." If both gene symbol and organism are known, use a query format such as "crcB[gene name] AND zucineum[orgn]." If multiple records are found, select the appropriate record to view homologous genes listed at the top of the report. If HomoloGene returns no records, search the Gene database with the gene name and follow the HomoloGene link if available .

  • Starting with protein sequence approach:

    • Obtain the protein sequence of P. zucineum CrcB homolog

    • Go to the BLAST homepage and select "protein blast"

    • Paste the sequence in the query box

    • Specify the organism of interest in the "Organism" box if looking for homologs in specific species

    • Run the BLAST search and analyze the results for potential homologs

  • Starting with protein accession number: Use the UniProt accession number B4R910 to search the Protein database. Then follow the "More about the gene" link and proceed with HomoloGene analysis .

  • For comprehensive homolog identification: Combine sequence-based approaches with structural analysis and functional domain identification. Tools like InterPro, Pfam, and PROSITE can help identify conserved domains characteristic of CrcB proteins, which may detect distant homologs that sequence-based methods alone might miss.

These computational approaches should be complemented with phylogenetic analyses to establish evolutionary relationships among identified homologs and to distinguish between orthologous and paralogous relationships.

What are the recommended protocols for working with recombinant P. zucineum CrcB homolog protein?

When working with recombinant P. zucineum CrcB homolog protein, researchers should follow these methodological recommendations:

Storage and Handling:

  • Store the protein at -20°C for routine use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

Experimental Considerations:

  • Protein Concentration and Purity Assessment:

    • Use Bradford or BCA assays for protein quantification

    • Verify purity via SDS-PAGE with Coomassie staining

    • Western blotting can confirm protein identity using anti-tag antibodies

  • Functional Studies:

    • Since CrcB homologs are associated with fluoride ion channels in many bacteria, ion transport assays may be appropriate

    • Consider using fluoride-sensitive electrodes or fluorescent probes to measure ion transport

    • Structural studies might employ circular dichroism spectroscopy to assess secondary structure elements

  • Interaction Studies:

    • Co-immunoprecipitation can identify protein-protein interactions

    • For membrane proteins like CrcB homologs, consider membrane-specific techniques such as crosslinking followed by mass spectrometry

  • For ELISA Applications:

    • Optimize antibody concentrations through titration experiments

    • Include appropriate positive and negative controls

    • Consider the tag type used during production for detection strategies

How can researchers effectively express and purify CrcB homolog for experimental studies?

For effective expression and purification of the CrcB homolog protein from P. zucineum, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli expression systems (such as BL21(DE3)) are commonly used for bacterial protein expression

  • For membrane proteins like CrcB homologs, specialized E. coli strains (C41(DE3) or C43(DE3)) designed for membrane protein expression may improve yields

  • Consider using a variety of tags (His, GST, MBP) to optimize solubility and purification; note that tag types may vary during production processes

Expression Protocol:

  • Transform expression vector into appropriate host strain

  • Grow cultures at optimal temperature (typically 37°C) until reaching OD600 of 0.6-0.8

  • For membrane proteins, induce with lower IPTG concentrations (0.1-0.5 mM) and reduce temperature to 16-25°C

  • Continue expression for 4-16 hours depending on protein stability and toxicity

Purification Strategy:

  • Cell Lysis: Use appropriate buffer containing protease inhibitors; for membrane proteins, include detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS

  • Initial Purification: Affinity chromatography based on the fusion tag (Ni-NTA for His-tagged proteins)

  • Secondary Purification: Size exclusion chromatography to remove aggregates and improve purity

  • Quality Control: SDS-PAGE analysis, Western blotting, and mass spectrometry to confirm identity and purity

Refolding Considerations:
If the protein forms inclusion bodies, consider solubilization in denaturants followed by step-wise dialysis to remove denaturants and allow proper refolding. For membrane proteins like CrcB homologs, detergent screening may be necessary to identify conditions that maintain native structure.

What cell-based assays are most informative for studying the function of CrcB homolog in P. zucineum?

Given the intracellular nature of P. zucineum and the potential role of CrcB homolog in bacterial physiology and host interactions, several cell-based assays would be particularly informative:

Infection and Intracellular Survival Assays:

  • Infect human cell lines (such as K562 or SW480 that have been documented to support P. zucineum infection) with wild-type and CrcB knockout strains

  • Monitor bacterial entry and persistence using fluorescence microscopy with labeled bacteria

  • Quantify intracellular bacteria at various time points post-infection by CFU counting after host cell lysis

Ion Channel Function Assays:

  • Given that CrcB homologs in other bacteria function as fluoride channels, perform fluoride sensitivity assays

  • Compare growth of wild-type and CrcB mutant strains in media containing varying concentrations of fluoride

  • Use fluoride-sensitive fluorescent probes to monitor intracellular fluoride levels in bacteria

Host-Pathogen Interaction Studies:

  • Analyze changes in host cell gene expression upon infection with wild-type versus CrcB mutant P. zucineum using RNA-seq

  • Assess cytokine production and inflammatory responses in infected host cells

  • Investigate potential co-localization of CrcB with host cell structures using immunofluorescence microscopy

Cell Cycle Analysis:

  • Since P. zucineum is related to C. crescentus, a model organism for cell cycle studies, and given the documented CtrA regulon conservation, investigate potential roles of CrcB in cell cycle regulation

  • Synchronize bacterial cultures and analyze CrcB expression levels at different cell cycle stages

  • Assess phenotypic effects of CrcB overexpression or depletion on bacterial cell division patterns

Long-term Co-culture Studies:

  • Establish stable co-cultures of host cells and P. zucineum (wild-type and CrcB variants)

  • Monitor long-term effects on both host and bacterial populations

  • This approach leverages P. zucineum's unique ability to establish stable, non-destructive intracellular infections

How might the CrcB homolog contribute to P. zucineum's unique intracellular lifestyle?

The CrcB homolog may play several significant roles in P. zucineum's distinctive intracellular lifestyle, though specific mechanisms require further investigation:

Ion Homeostasis and Environmental Adaptation:
CrcB homologs in other bacteria function as fluoride channels or transporters, conferring resistance to environmental fluoride. Within the intracellular environment, this function may be repurposed to manage various ionic challenges or participate in maintaining appropriate cytoplasmic conditions for persistent infection. P. zucineum shows a relatively high proportion of genes involved in two-component signal transduction and transcriptional regulation, which correlates positively with environmental adaptation capacity. The CrcB homolog may be integrated into these complex signaling networks .

Host Cell Interaction and Modulation:
The stable, non-destructive association that P. zucineum establishes with host cells suggests sophisticated mechanisms for modulating host cell responses. CrcB homolog might participate in:

  • Controlling cell envelope properties that interface with host detection systems

  • Contributing to membrane stability or modification in response to host defense mechanisms

  • Facilitating transport of specific compounds across bacterial membranes during intracellular residence

Metabolic Adaptation:
P. zucineum can utilize L-phenylalanine as a sole carbon source and possesses complete enzyme sets for glycolysis and the Entner-Doudoroff pathway. The CrcB homolog may contribute to metabolic adaptation by:

  • Participating in membrane transport of metabolites

  • Responding to metabolic signals that coordinate bacterial growth with intracellular resources

  • Helping maintain appropriate internal conditions for metabolic processes within the host environment

Cell Cycle Regulation:
Given P. zucineum's phylogenetic relationship with Caulobacter crescentus and the conservation of the CtrA regulon between these species, CrcB might play a role in the regulated cell cycle progression that allows for controlled, non-destructive growth within host cells. This controlled growth is essential for establishing the stable, long-term infections characteristic of P. zucineum .

What insights can comparative genomics provide about the functional evolution of CrcB homologs across bacterial species?

Comparative genomics offers several valuable insights into the functional evolution of CrcB homologs:

Evolutionary Conservation and Divergence:
The CrcB protein family appears to be widely distributed across bacterial species, suggesting fundamental importance in bacterial physiology. Comparative analysis can reveal:

  • Core conserved domains that likely represent essential functional regions

  • Species-specific variations that may reflect adaptation to different ecological niches

  • Patterns of selection pressure indicating functional constraints or adaptive evolution

Genomic Context and Functional Associations:
In P. zucineum, the crcB gene is located on the chromosome (locus identifier: PHZ_c1266). Analysis of the genomic neighborhood of crcB across different species can provide clues about functional associations:

  • Co-localization with genes of known function might suggest participation in specific pathways

  • Conserved operonic structures across species can indicate functional relationships

  • Presence in genomic islands or regions with atypical GC content might suggest acquisition through horizontal gene transfer

Phylogenetic Profiling:
The distribution pattern of CrcB homologs across the bacterial phylogenetic tree can provide insights into:

  • The ancestral state and evolutionary trajectory of this protein family

  • Correlation with specific bacterial lifestyles (free-living, facultative intracellular, obligate intracellular)

  • Co-evolution with other protein families suggesting functional interaction networks

Structural Homology:
While the three-dimensional structure of P. zucineum's CrcB homolog has not been experimentally determined, structural predictions based on homology to crystallized bacterial CrcB proteins can inform:

  • Potential membrane topology and channel architecture

  • Critical residues for ion selectivity and gating

  • Structural adaptations that might relate to P. zucineum's unique lifestyle

The close phylogenetic relationship between P. zucineum and C. crescentus provides an excellent comparative framework, as C. crescentus is well-studied with extensive functional genomic data available. The conservation of regulatory networks (such as the CtrA regulon) between these species suggests that insights from C. crescentus might be applicable to understanding CrcB function in P. zucineum .

How can structural biology approaches enhance our understanding of CrcB homolog function?

Structural biology approaches can significantly advance our understanding of the P. zucineum CrcB homolog by elucidating its molecular architecture and functional mechanisms:

X-ray Crystallography and Cryo-EM Studies:

  • Determine high-resolution 3D structure of the CrcB homolog to identify functional domains and critical residues

  • For membrane proteins like CrcB homologs, lipidic cubic phase crystallization or nanodisc incorporation may improve success rates

  • Use of stabilizing mutations or antibody fragments can enhance crystallization properties

  • Cryo-EM may be particularly suitable for membrane proteins and can reveal different conformational states

NMR Spectroscopy:

  • Solution NMR can provide dynamic information about protein movements

  • Solid-state NMR is well-suited for membrane proteins

  • Can determine residue-specific information about protein-ligand interactions

  • Particularly valuable for studying conformational changes upon ion binding

Molecular Dynamics Simulations:

  • Based on experimental structures or reliable homology models

  • Can simulate ion transport through the channel in a lipid bilayer environment

  • Predict effects of mutations on structure and function

  • Model interactions with other proteins or host cellular components

Structure-Function Relationship Studies:

  • Site-directed mutagenesis of predicted functional residues followed by functional assays

  • Chimeric proteins combining domains from different bacterial CrcB homologs to determine domain-specific functions

  • Cross-linking studies to capture interaction partners

Integrated Structural Biology Approach:
For the most comprehensive understanding, combine multiple structural techniques with functional data:

Structural MethodInformation ProvidedComplementary Functional Assays
X-ray CrystallographyHigh-resolution static structureIon flux measurements
Cryo-EMMultiple conformational statesFluoride sensitivity assays
NMR SpectroscopyDynamic information, ligand bindingBinding affinity measurements
Molecular DynamicsSimulated movements and energeticsMutagenesis validation
HDX-MSConformational flexibility, protein interactionsCrosslinking and co-IP

The combined structural and functional data would allow researchers to establish a mechanistic model of CrcB homolog function in P. zucineum, particularly in relation to its unique intracellular lifestyle and potential roles in host interaction .

What are the major technical challenges in studying the CrcB homolog from P. zucineum?

Researchers face several significant technical challenges when investigating the CrcB homolog from P. zucineum:

Cultivation and Genetic Manipulation Challenges:

  • P. zucineum is a facultative intracellular bacterium with specific growth requirements

  • Developing efficient genetic manipulation systems for this organism may be difficult

  • Creating targeted mutations in the crcB gene requires optimized transformation protocols

  • Maintaining stable P. zucineum cultures both in axenic conditions and in co-culture with host cells can be technically demanding

Membrane Protein-Specific Difficulties:

  • As a potential membrane protein, the CrcB homolog presents challenges in expression, purification, and structural studies

  • Maintaining native conformation during purification requires careful detergent selection

  • Low expression yields are common for membrane proteins

  • Protein aggregation or misfolding during recombinant expression may necessitate extensive optimization

Functional Assay Development:

  • The precise function of the CrcB homolog in P. zucineum remains to be fully characterized

  • Developing specific, sensitive assays to measure potential ion channel activity requires specialized equipment

  • Distinguishing CrcB-specific effects from other cellular processes in complex host-pathogen interactions is challenging

  • The unique stable intracellular lifestyle of P. zucineum necessitates long-term experimental designs that are resource-intensive

Structure Determination Limitations:

  • Membrane proteins are underrepresented in structural databases due to technical difficulties

  • Crystal formation can be particularly challenging

  • High-resolution structures may require extensive screening of conditions and constructs

  • The dynamic nature of channel proteins may require capturing multiple conformational states

Biological Containment Considerations:

  • As P. zucineum was isolated from a human leukemia cell line and can infect human cells, appropriate biosafety measures must be implemented

  • Working with potentially pathogenic organisms requires specialized facilities and training

  • These containment requirements may limit accessibility for some research groups

How might research on CrcB homologs contribute to our understanding of bacterial adaptation to intracellular environments?

Research on CrcB homologs has significant potential to advance our understanding of bacterial adaptation to intracellular environments in several key areas:

Novel Survival Mechanisms:
P. zucineum's unique ability to establish stable, non-destructive intracellular infections suggests sophisticated adaptation mechanisms. If CrcB homologs contribute to this lifestyle, understanding their function could reveal novel strategies bacteria employ to persist within host cells without triggering destructive responses .

Ion Homeostasis in Intracellular Adaptation:
Given that CrcB homologs in other bacteria function as fluoride channels, research might reveal how ion transport systems are repurposed during intracellular adaptation. The intracellular environment presents distinct ionic challenges compared to extracellular habitats, requiring specific regulatory mechanisms to maintain bacterial homeostasis.

Host-Pathogen Interface Regulation:
CrcB homologs could participate in regulating the bacterial cell envelope properties that interface with host detection systems. Understanding these interactions may reveal:

  • How bacteria modulate surface properties to evade host immune recognition

  • Mechanisms for adapting to intracellular stress conditions

  • Signaling systems that detect and respond to the host environment

Comparative Genomic Insights:
By comparing CrcB homologs across bacteria with different host relationships (free-living, facultative intracellular, obligate intracellular), researchers can:

  • Identify evolutionary adaptations associated with intracellular lifestyles

  • Discover convergent adaptations in unrelated intracellular bacteria

  • Map the trajectory of gene function changes during the evolution of host associations

Cell Cycle Regulation in Persistent Infections:
The connection between P. zucineum and C. crescentus, particularly the conservation of the CtrA regulon, suggests potential roles for CrcB in coordinated cell cycle control. Understanding how intracellular bacteria regulate their replication to maintain persistent infections without overwhelming the host could have broad implications for understanding chronic bacterial infections .

What are promising future research directions for understanding the biological significance of the CrcB homolog in bacterial physiology and pathogenesis?

Several promising research directions could significantly advance our understanding of the CrcB homolog's biological significance:

Genetic Manipulation and Phenotypic Analysis:

  • Generate crcB knockout and complemented strains in P. zucineum

  • Assess effects on growth, stress resistance, and intracellular survival

  • Perform comprehensive phenotypic characterization under various environmental conditions

  • Use conditional expression systems to study essential functions

Transcriptomic and Proteomic Profiling:

  • Compare gene expression profiles between wild-type and crcB mutant strains

  • Identify the CrcB regulon through RNA-seq and ChIP-seq approaches

  • Determine if CrcB expression is regulated by the CtrA system, given the conservation of the CtrA regulon between P. zucineum and C. crescentus

  • Use proteomics to identify interaction partners and post-translational modifications

Advanced Microscopy Approaches:

  • Utilize super-resolution microscopy to determine subcellular localization

  • Employ live-cell imaging to track CrcB dynamics during infection processes

  • Use FRET-based approaches to study protein-protein interactions in living cells

  • Implement correlative light and electron microscopy to combine functional and ultrastructural information

Comparative Host Response Analysis:

  • Compare host transcriptional responses to wild-type versus crcB mutant bacteria

  • Identify host pathways specifically modulated by CrcB-dependent processes

  • Investigate whether CrcB contributes to the non-destructive nature of P. zucineum infections

  • Assess potential CrcB-dependent effects on host cell cycle or metabolism

Therapeutic Targeting and Biotechnological Applications:

  • Evaluate CrcB homologs as potential targets for disrupting persistent bacterial infections

  • Explore applications of the stable host-bacteria relationship for biotechnology

  • Investigate whether CrcB-dependent processes could be harnessed for targeted drug delivery

  • Develop screening systems for compounds that modulate CrcB function

Evolutionary and Ecological Studies:

  • Examine the distribution and variation of crcB genes across bacterial species with different lifestyles

  • Investigate horizontal gene transfer patterns of crcB genes

  • Study crcB adaptation in laboratory evolution experiments under different selective pressures

  • Compare CrcB function in environmental versus host-associated strains of Phenylobacterium species

These research directions would not only illuminate the specific roles of the CrcB homolog in P. zucineum but could also provide broader insights into bacterial adaptation mechanisms and host-microbe interactions that may be applicable to understanding persistent bacterial infections in human health and disease .

What are the key takeaways from current research on P. zucineum and its CrcB homolog?

Current research on P. zucineum and its CrcB homolog protein reveals several important scientific insights:

First, P. zucineum represents a fascinating model system for studying stable host-bacteria interactions. Unlike typical intracellular pathogens that cause host cell destruction, P. zucineum establishes long-term, non-destructive relationships with human cells, maintained for years in laboratory settings. This unique property suggests sophisticated molecular mechanisms for modulating host responses and bacterial replication .

Second, genomic analysis positions P. zucineum as phylogenetically closest to Caulobacter crescentus, with conservation of key regulatory systems including the CtrA regulon. This evolutionary relationship provides a valuable comparative framework for understanding the functional adaptation of cellular processes during the evolution of intracellular lifestyles .

Third, while the specific function of the CrcB homolog in P. zucineum remains to be fully characterized, information from other bacterial systems suggests potential roles in ion transport, membrane homeostasis, or stress responses. The protein's 127-amino acid sequence and chromosomal location (locus PHZ_c1266) have been determined, providing a foundation for further functional studies .

Fourth, P. zucineum possesses metabolic versatility, including the ability to use L-phenylalanine as a sole carbon source and complete pathways for glycolysis and the Entner-Doudoroff pathway. This metabolic capacity likely contributes to its ability to thrive in diverse environments, including intracellularly .

Finally, the stable host-pathogen relationship demonstrated by P. zucineum represents an evolutionary strategy distinct from acute pathogenesis, potentially providing insights into mechanisms of bacterial persistence relevant to chronic infections in humans.

How might insights from CrcB homolog research translate to applications in biotechnology or medicine?

Research on the CrcB homolog from P. zucineum could translate to several innovative applications in biotechnology and medicine:

Novel Antimicrobial Strategies:
If CrcB proves essential for P. zucineum's intracellular survival, it could represent a new target for antimicrobials aimed at persistent bacterial infections. Understanding the structure and function of CrcB homologs might enable the design of specific inhibitors that disrupt intracellular bacterial persistence without affecting commensal bacteria.

Cell-Based Delivery Systems:
P. zucineum's ability to establish stable intracellular residence without destroying host cells could be harnessed for biotechnological applications. Engineered P. zucineum strains, with modifications to the CrcB homolog or related systems, might serve as vectors for delivering therapeutic proteins, nucleic acids, or small molecules directly into specific cell types.

Host-Directed Therapy Development:
Understanding how P. zucineum modulates host cell responses through CrcB-dependent mechanisms could inform the development of host-directed therapies. These approaches would target host processes exploited by intracellular pathogens rather than the pathogens themselves, potentially overcoming issues of antimicrobial resistance.

Biosensors and Diagnostic Tools:
The ion channel properties of CrcB homologs could be exploited to develop biosensors for environmental monitoring or diagnostic applications. For example, modified CrcB proteins might be engineered to detect specific ions or molecules with relevance to health monitoring.

Cell Line Development:
Understanding the molecular basis of P. zucineum's stable relationship with human cells could inform the development of improved cell lines for biotechnology applications. This might include enhancing cell longevity, stability, or productivity in biomanufacturing processes.

Fundamental Understanding of Persistent Infections:
Many chronic bacterial infections involve persistent intracellular bacteria that evade immune clearance and antibiotic treatment. Insights from P. zucineum's CrcB homolog might illuminate conserved mechanisms that contribute to bacterial persistence, potentially informing new approaches to treating recalcitrant infections such as tuberculosis, Q fever, or certain Salmonella infections.

What methodological advances would accelerate progress in understanding CrcB homolog function across bacterial species?

Several methodological advances would significantly accelerate progress in understanding CrcB homolog function across bacterial species:

Advanced Genetic Tools for Non-Model Bacteria:

  • Development of efficient transformation protocols and genetic manipulation systems for P. zucineum

  • Creation of CRISPR-Cas9 based genome editing tools optimized for diverse bacterial species

  • Inducible gene expression and knockdown systems for studying essential genes

  • Site-specific recombination systems for controlled integration of reporter constructs

Improved Membrane Protein Technologies:

  • Better expression systems specifically designed for challenging membrane proteins

  • Advanced detergent and nanodisk systems for maintaining native membrane protein conformations

  • High-throughput approaches for membrane protein crystallization condition screening

  • Development of lipid cubic phase technologies for improved membrane protein structure determination

Single-Cell and Single-Molecule Techniques:

  • Single-cell transcriptomics and proteomics to capture cell-to-cell variation in bacterial populations

  • Super-resolution microscopy approaches to visualize protein localization within bacterial cells at nanoscale resolution

  • Single-molecule tracking to follow CrcB dynamics in living cells

  • Patch-clamp electrophysiology adapted for bacterial ion channels

Systems Biology Integration Platforms:

  • Computational frameworks that integrate genomic, transcriptomic, proteomic, and metabolomic data

  • Machine learning approaches to identify patterns in complex host-pathogen interaction datasets

  • Pathway modeling tools to predict effects of CrcB perturbation on bacterial physiology

  • Comparative genomics pipelines specifically designed for membrane protein evolution analysis

Standardized Assay Development:

  • Development of standardized functional assays for CrcB homologs across species

  • High-throughput screening systems for CrcB modulators

  • Reporter systems to monitor CrcB expression and localization in real-time during infection

  • Quantitative assays for measuring ion flux in bacterial systems

Host-Pathogen Interaction Models:

  • Development of improved co-culture systems that better mimic physiological conditions

  • Organoid-based infection models for studying tissue-specific bacterial interactions

  • Animal models with humanized tissue components for studying host specificity

  • Long-term infection models suitable for studying persistent bacterial relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.