Recombinant Phoca vitulina NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please communicate this need in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please communicate it to us. We will prioritize fulfilling your specified tag preference.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Phoca vitulina (Harbor seal)
Target Names
Target Protein Sequence
MSMVYANIFLAFIMSLMGLLMYRSHLMSSLLCLEGMMLSLFVMMTVTILNNHFTLASMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its function in mitochondrial metabolism?

MT-ND4L is a mitochondrially-encoded gene that produces NADH-ubiquinone oxidoreductase chain 4L, a critical component of respiratory complex I (NADH:ubiquinone oxidoreductase). This protein plays an essential role in the electron transport chain of mitochondria. Complex I serves several vital functions in cellular metabolism: it maintains the intramitochondrial NADH/NAD+ ratio, contributes significantly to the generation of the proton-motive force, and participates in both physiological and pathophysiological production of reactive oxygen species .

As part of complex I, MT-ND4L contributes to the first step of the electron transport chain, where NADH is oxidized and electrons are transferred to ubiquinone. In the context of Phoca vitulina (Harbor seal), this protein is encoded in the mitochondrial genome alongside other ND subunits (ND1-6, ND4L) as demonstrated in genomic analyses of related seal species .

How is recombinant Phoca vitulina MT-ND4L typically expressed in laboratory settings?

Recombinant Phoca vitulina MT-ND4L is typically expressed using prokaryotic expression systems. Based on available product information, the full-length MT-ND4L protein (amino acids 1-98) can be successfully expressed in E. coli with an N-terminal His tag to facilitate purification . This expression system allows for the production of sufficient quantities of protein for experimental use.

The expression in E. coli typically involves:

  • Transformation of expression vectors containing the MT-ND4L gene sequence into suitable E. coli strains

  • Induction of protein expression using appropriate inducers

  • Cell lysis and extraction of the recombinant protein

  • Affinity purification using the His tag

  • Quality control assessment via SDS-PAGE to ensure >90% purity

The resulting product is typically prepared as a lyophilized powder, allowing for long-term storage and subsequent reconstitution for experimental use.

How stable is recombinant MT-ND4L protein under various laboratory conditions?

Recombinant MT-ND4L requires careful handling to maintain stability and activity. Based on available information, the following stability characteristics should be considered:

  • Temperature sensitivity: The protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use .

  • Freeze-thaw sensitivity: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Working conditions: Working aliquots can be stored at 4°C for up to one week .

  • Stabilizing agents: The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage .

  • Post-reconstitution: Addition of glycerol (typically 5-50% final concentration) is recommended for long-term storage of reconstituted protein .

These storage and handling recommendations are critical for maintaining the structural integrity and functionality of the recombinant protein for experimental applications.

What are appropriate reconstitution protocols for lyophilized MT-ND4L protein?

For optimal reconstitution of lyophilized recombinant MT-ND4L protein, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to bring contents to the bottom .

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot the solution .

  • Store the reconstituted and glycerol-supplemented protein at -20°C/-80°C for extended stability .

  • Avoid repeated freeze-thaw cycles by preparing multiple small-volume aliquots.

Proper reconstitution is essential for maintaining the protein's structural integrity and functional properties for subsequent experimental applications.

How does the A/D transition of complex I (containing MT-ND4L) affect experimental design when studying mitochondrial function?

The A/D (Active/Deactive) transition is a characteristic feature of mitochondrial complex I that significantly impacts experimental design. This phenomenon represents a slow transformation of complex I to its inactive (deactivated) state compared with its catalytic turnover . When designing experiments involving MT-ND4L as part of complex I, researchers should consider:

  • Temperature dependence: The deactivation process is strongly temperature-dependent, showing deviation from first-order kinetics . Experiments should maintain consistent temperature conditions and account for temperature effects on the equilibrium between active and deactive forms.

  • pH considerations: The rate of complex I deactivation is slightly pH dependent within the range of 7.0-8.5 but increases significantly at higher pH . Buffer systems should be carefully selected to maintain optimal pH for the desired experimental conditions.

  • The role of sulfhydryl groups: The presence of SH-group-specific reagents can abolish deviations in deactivation kinetics . Researchers should consider the potential interaction of such reagents with complex I components, including MT-ND4L.

  • ATP effects: ATP·(Mg) decreases the rate of complex I deactivation in coupled submitochondrial particles, an effect that is abolished if the proton-motive force generating ATPase activity is prevented . Experimental designs should account for the energy state of mitochondria and the presence of ATP.

  • Equilibrium considerations: Evidence suggests that an equilibrium exists between the A and D forms of complex I , which should be factored into data interpretation and experimental planning.

Understanding these factors is crucial for designing rigorous experiments and interpreting results accurately when studying MT-ND4L's function within complex I.

What methodological approaches can be used to study genetic diversity of MT-ND4L across different seal populations?

Research on genetic diversity of mitochondrial genes, including MT-ND4L, across seal populations employs several methodological approaches:

  • DNA sequencing and alignment: Sequences can be aligned using tools such as ClustalW and analyzed in software packages like MEGA for comparative analysis of nucleotide and amino acid sequences .

  • Assessment of genetic diversity indices: Software like ARLEQUIN can be used to calculate:

    • Number of haplotypes

    • Polymorphic sites

    • Transitions and transversions

    • Haplotype diversity (h)

    • Nucleotide diversity (π)

    • Mean number of pairwise differences (k)

  • Phylogenetic analysis: Neighbor-joining trees can be constructed using programs like MEGA5.0 and evaluated with bootstrap replicates to establish relationships between populations .

  • Population structure analysis: Pairwise genetic divergences between different populations can be tested using the fixation index Fst, with significance tested through permutations .

  • Hierarchical population structure examination: Analysis of molecular variance (AMOVA) can be used to examine geographical patterns of population subdivision .

  • Neutrality tests: The D test of Tajima and Fs test of Fu can be employed to test for neutrality and potentially identify signatures of population expansion .

  • Mismatch distribution analysis: This approach tests the concordance of observed distributions with expected distributions in the sudden-expansion model .

These methodological approaches provide a comprehensive framework for understanding genetic diversity and evolutionary relationships of MT-ND4L across different seal populations.

How can researchers design experiments to understand the pH and temperature dependence of MT-ND4L function within complex I?

Designing experiments to investigate the pH and temperature dependence of MT-ND4L function within complex I requires a systematic approach:

  • Isolation of submitochondrial particles (SMPs):

    • Prepare coupled or uncoupled bovine heart SMPs as experimental models

    • Ensure consistent quality and activity of prepared SMPs

    • Characterize baseline complex I activity under standard conditions

  • Temperature-dependent experiments:

    • Design a temperature gradient experiment (typically 4-37°C)

    • Monitor complex I activity at timed intervals following incubation at different temperatures

    • Plot deactivation kinetics to determine deviation from first-order kinetics

    • Calculate activation energy for the deactivation process

  • pH-dependent experiments:

    • Prepare buffer systems ranging from pH 7.0 to 9.0

    • Measure rates of complex I deactivation across the pH spectrum

    • Analyze the relationship between pH and deactivation kinetics

    • Determine critical pH thresholds that significantly alter deactivation rates

  • ATP dependence studies:

    • Compare deactivation rates in the presence and absence of ATP·(Mg)

    • Investigate the role of proton-motive force by uncoupling experiments

    • Determine the mechanism by which ATP affects complex I stability

  • SH-group modification experiments:

    • Use specific SH-group reagents to modify critical thiols

    • Monitor changes in deactivation kinetics following modification

    • Identify potential SH-groups in MT-ND4L that may participate in the A/D transition

  • Residual activity analysis:

    • Measure the kinetics of NADH oxidation in partially deactivated complex I

    • Compare with fully active enzyme to determine if residual activity represents a distinct population of active complex I or a different catalytic state

These experimental approaches would provide comprehensive insights into how environmental factors affect MT-ND4L function within the context of complex I activity.

What are the challenges in comparative analysis of MT-ND4L across different seal species?

Comparative analysis of MT-ND4L across different seal species presents several methodological challenges that researchers must address:

Addressing these challenges requires rigorous methodological approaches and careful experimental design to ensure valid comparisons of MT-ND4L across different seal species or populations.

How can recombinant MT-ND4L be integrated into functional assays to study mitochondrial complex I activity?

Integration of recombinant MT-ND4L into functional assays requires careful consideration of the protein's properties and complex I assembly:

  • Protein preparation:

    • Reconstitute lyophilized recombinant MT-ND4L following recommended protocols

    • Verify protein integrity and purity using SDS-PAGE

    • Consider adding stabilizing agents appropriate for the specific assay conditions

  • Incorporation into membrane systems:

    • Prepare proteoliposomes containing recombinant MT-ND4L

    • Optimize lipid composition to mimic mitochondrial inner membrane

    • Ensure proper orientation of the protein within the membrane

  • Complex I reconstitution approaches:

    • Co-express or combine MT-ND4L with other complex I subunits

    • Monitor assembly of subcomplexes using blue native PAGE

    • Verify structural integrity of reconstituted complexes

  • Activity assays:

    • Measure NADH oxidation rates using spectrophotometric methods

    • Assess ubiquinone reduction in reconstituted systems

    • Monitor proton pumping activity using pH-sensitive probes

    • Evaluate ROS production associated with complex I activity

  • A/D transition studies:

    • Examine temperature and pH dependence of activity

    • Investigate the effects of SH-group modifiers on function

    • Assess the impact of ATP and energy state on activity

    • Determine the equilibrium between active and deactive forms

  • Validation approaches:

    • Compare activity of reconstituted systems with native mitochondrial preparations

    • Use inhibitors specific to different segments of complex I

    • Perform complementation studies with native subcomplexes

These methodological approaches allow researchers to integrate recombinant MT-ND4L into functional assays to study specific aspects of mitochondrial complex I activity, providing insights into both normal function and potential pathological mechanisms.

How can MT-ND4L research contribute to understanding marine mammal adaptation to environmental changes?

Research on MT-ND4L in species like Phoca vitulina offers valuable insights into marine mammal adaptation:

  • Population genetic analysis: Studies on related seal species have shown that mitochondrial DNA, including MT-ND4L, can reveal population structures and genetic diversity patterns that reflect historical and ongoing adaptations .

  • Energetic adaptation assessment: As part of complex I, MT-ND4L plays a crucial role in energy metabolism. Analyzing its sequence and functional variations across populations can help understand how marine mammals adapt their energy metabolism to different environmental conditions.

  • Evolutionary history reconstruction: Phylogenetic analysis of MT-ND4L and other mitochondrial genes has shown that seal populations from different geographical regions (e.g., Liaodong Gulf, Korea, Alaska) have distinct genetic profiles, revealing their evolutionary history and adaptation patterns .

  • Monitoring population responses: The high haplotype diversity but lower nucleotide diversity observed in some seal populations suggests recent population expansion events, potentially in response to environmental changes .

  • Conservation genetics applications: Understanding the genetic diversity of MT-ND4L and other mitochondrial genes provides essential information for conservation strategies aimed at maintaining the genetic health of marine mammal populations.

The methodological approaches for these applications include comprehensive genetic sampling, comparative sequence analysis, phylogenetic reconstruction, and population genetic analyses using tools such as ARLEQUIN and MEGA to assess diversity indices, population structure, and evolutionary relationships .

What techniques can be employed to investigate the relationship between MT-ND4L mutations and bioenergetic dysfunction?

Investigation of MT-ND4L mutations and their impact on bioenergetic function requires multi-faceted methodological approaches:

  • Mutation identification and characterization:

    • Targeted sequencing of MT-ND4L across populations

    • Analysis of mutation frequencies and conservation patterns

    • Structural modeling to predict functional impacts of mutations

  • In vitro functional assessment:

    • Site-directed mutagenesis to introduce specific mutations into recombinant MT-ND4L

    • Expression and purification of mutant proteins

    • Reconstitution into membrane systems for functional testing

  • Complex I activity assays:

    • Spectrophotometric measurement of NADH oxidation rates

    • Ubiquinone reduction kinetics

    • Assessment of proton pumping efficiency

    • Measurement of ROS production under various conditions

  • A/D transition analysis:

    • Comparison of A/D transition kinetics between wild-type and mutant proteins

    • Evaluation of temperature and pH dependence

    • Assessment of SH-group accessibility and modification rates

  • Cellular bioenergetic assessment:

    • Oxygen consumption rate measurements

    • Membrane potential analysis

    • ATP production capacity

    • Metabolic profiling to identify downstream effects

  • Integration with systems biology approaches:

    • Transcriptomic analysis to identify compensatory mechanisms

    • Metabolomic profiling to assess metabolic consequences

    • Proteomic analysis to identify altered protein interactions

These methodological approaches provide a comprehensive framework for investigating how MT-ND4L mutations affect bioenergetic function, potentially contributing to our understanding of mitochondrial disorders and evolutionary adaptations in marine mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.