Recombinant Phocoenoides phocoena NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant MT-ND4L

Recombinant Phocoenoides phocoena NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a synthetic protein engineered from the harbor porpoise (Phocoenoides phocoena). It represents a core subunit of mitochondrial Complex I (NADH dehydrogenase), a critical enzyme in cellular energy production via oxidative phosphorylation. This recombinant variant is produced through heterologous expression systems to study mitochondrial function, disease mechanisms, and therapeutic targets .

Amino Acid Sequence and Length

The recombinant MT-ND4L from Phocoenoides phocoena comprises 98 amino acids, with the sequence:
MSLIHINILMAFTMSLVGLLMYRSHLMSALLCLEGMVLSLFILMTLTILNSHFTLANMVP IILLVFAACEAAIGLALLVMVSNTYGTDYVQNLNLLQC .

Molecular Weight and Conformation

  • Molecular Weight: Estimated ~10–11 kDa (similar to human MT-ND4L) .

  • Conformation: Hydrophobic transmembrane domains and hydrophilic regions for electron transfer, consistent with mitochondrial Complex I architecture .

Gene Overlap and Mitochondrial Origin

In Phocoenoides phocoena, the MT-ND4L gene overlaps with the MT-ND4 gene, a feature conserved across species to optimize mitochondrial genome space .

Functional Role in Mitochondrial Complex I

MT-ND4L is essential for:

  1. Electron Transfer: Facilitates NADH → ubiquinone (CoQ10) electron transport .

  2. Proton Pumping: Contributes to the proton gradient across the inner mitochondrial membrane, driving ATP synthesis .

  3. Structural Integrity: Forms the hydrophobic core of Complex I, stabilizing its L-shaped structure .

Disease Modeling and Therapeutics

ApplicationDetailsSource
Leber’s Hereditary Optic Neuropathy (LHON)Mutations in MT-ND4L (e.g., Val65Ala) disrupt Complex I activity, impairing ATP production and optic nerve function .
Mitochondrial Complex I DeficiencyRecombinant MT-ND4L aids in studying assembly defects linked to metabolic disorders .

AI-Driven Drug Discovery

  • Virtual Screening: AI models predict small-molecule ligands targeting MT-ND4L binding pockets for therapeutic modulation .

  • Conformational Analysis: AI-generated ensembles identify dynamic states critical for electron transfer and inhibitor design .

Clinical and Biotechnological Significance

  • Mitochondrial Disorders: MT-ND4L variants are linked to obesity, diabetes, and hypertension .

  • Evolutionary Insights: Nuclear-encoded ND4L in Chlamydomonas highlights gene transfer and mitochondrial adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Phocoena phocoena (Harbor porpoise)
Target Names
Target Protein Sequence
MSLIHINILMAFTMSLVGLLMYRSHLMSALLCLEGMVLSLFILMTLTILNSHFTLANMVP IILLVFAACEAAIGLALLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of MT-ND4L in Phocoenoides phocoena?

MT-ND4L is one of the core hydrophobic subunits of mitochondrial Complex I. In harbor porpoise, as in other mammals, the protein is encoded by the mitochondrial genome and produces a small but essential component of the membrane arm of Complex I. Based on comparative analysis with other mammalian MT-ND4L proteins, the harbor porpoise variant likely produces an approximately 11 kDa protein composed of 98 amino acids . The protein contains multiple transmembrane domains and forms part of the core structure of the membrane-embedded portion of Complex I, contributing to proton pumping across the inner mitochondrial membrane .

How does harbor porpoise MT-ND4L contribute to respiratory chain function?

MT-ND4L functions as an integral component of Complex I (NADH:ubiquinone oxidoreductase), which catalyzes the first step in the electron transport chain. This complex transfers electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane . As part of the membrane domain of Complex I, MT-ND4L likely participates in forming the proton translocation pathway. The protein contributes to creating the electrochemical gradient that drives ATP synthesis through oxidative phosphorylation . In harbor porpoise, this function is particularly critical for maintaining energy production during prolonged dives when oxygen availability is limited.

What is known about the gene structure of harbor porpoise MT-ND4L?

While specific harbor porpoise data is limited, comparative genomics suggests that the gene structure would follow the pattern observed in other mammals. The MT-ND4L gene would be located in mitochondrial DNA, likely spanning approximately 300 base pairs . An interesting feature likely preserved in harbor porpoise is the gene overlap observed in humans, where the last three codons of MT-ND4L overlap with the first three codons of MT-ND4 in a different reading frame . This compact genomic organization is a characteristic feature of mitochondrial genomes and represents an evolutionary adaptation for genomic efficiency.

What expression systems are most effective for recombinant harbor porpoise MT-ND4L?

Expressing highly hydrophobic mitochondrial proteins like MT-ND4L presents significant challenges. For harbor porpoise MT-ND4L, researchers should consider expression systems specifically designed for membrane proteins. Bacterial expression using specialized E. coli strains (such as C41/C43) with modified T7 promoter systems can be effective when the protein is expressed as a fusion with solubility-enhancing tags like MBP or SUMO. Alternatively, cell-free expression systems supplemented with lipid nanodiscs or detergents have shown promise for similar mitochondrial membrane proteins. For eukaryotic expression, insect cell systems using baculovirus vectors provide a more native-like membrane environment that may enhance proper folding of this highly hydrophobic protein.

How can researchers overcome purification challenges for harbor porpoise MT-ND4L?

Purification of recombinant MT-ND4L requires strategies that address its extreme hydrophobicity. A methodological approach includes:

  • Membrane extraction using mild detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)

  • Affinity chromatography utilizing N- or C-terminal tags (His6, FLAG, or Strep tags)

  • Size exclusion chromatography in detergent micelles or lipid nanodiscs

  • Careful buffer optimization to prevent aggregation (typically including 0.02-0.05% detergent and 10-15% glycerol)

Researchers should monitor protein quality throughout purification using techniques like SDS-PAGE and Western blotting with antibodies specific to MT-ND4L or epitope tags .

What strategies help maintain structural integrity during recombinant expression?

To preserve the structural integrity of harbor porpoise MT-ND4L during recombinant expression, consider:

  • Lowering expression temperature to 18-20°C to slow protein synthesis and improve folding

  • Co-expressing with membrane-integrating chaperones

  • Using expression vectors that target the protein to membranes

  • Incorporating native lipids from marine mammal mitochondria during solubilization

These approaches can significantly improve the proportion of correctly folded, functional protein obtained during purification.

What assays can measure activity of recombinant MT-ND4L in reconstituted systems?

When incorporated into reconstituted Complex I, recombinant harbor porpoise MT-ND4L can be functionally assessed through several complementary methods:

  • NADH:ubiquinone oxidoreductase activity assays measuring electron transfer rates (typically 3-5 μmol e⁻·min⁻¹·mg⁻¹ for fully assembled complex)

  • Proton translocation measurements using pH-sensitive fluorescent dyes in proteoliposomes

  • Superoxide production assays using cytochrome c reduction (typically 35-45 nmol e⁻·min⁻¹·mg⁻¹ under standard conditions)

  • Membrane potential measurements using potential-sensitive dyes

These functional assays should be performed in comparison with native Complex I and with reconstituted complexes lacking MT-ND4L to determine its specific contribution to enzyme function.

How does MT-ND4L contribute to superoxide production in Complex I?

The contribution to superoxide production can be assessed using the following parameters:

ConditionNADH Oxidation Rate (μmol e⁻·min⁻¹·mg⁻¹)Superoxide Production Rate (nmol e⁻·min⁻¹·mg⁻¹)% Electrons to Superoxide
WT Complex I~4.0-4.5~40-45~1.0%
Without MT-ND4L~1.5-2.0~25-30~1.5%
With mutant MT-ND4L~2.5-3.0~35-40~1.3%

What techniques can assess MT-ND4L integration into Complex I?

Proper integration of recombinant harbor porpoise MT-ND4L into Complex I can be evaluated using:

  • Blue Native PAGE to visualize assembled Complex I (typically 950 kDa when fully assembled)

  • Immunodetection with subunit-specific antibodies

  • Crosslinking mass spectrometry to identify interacting partners

  • Cryo-EM structural analysis of reconstituted complexes

  • Protease protection assays to confirm proper membrane topology

When MT-ND4L is correctly incorporated, Complex I will show appropriate assembly and catalytic activity. Absence of proper MT-ND4L integration typically prevents assembly of the complete 950 kDa complex and reduces enzyme activity .

How does harbor porpoise MT-ND4L differ from other mammalian homologs?

Harbor porpoise MT-ND4L likely contains adaptations reflecting the marine environment and diving physiology of these mammals. While specific sequence data for harbor porpoise MT-ND4L is limited in the provided sources, comparative analysis with other mammalian homologs would be expected to show:

  • Potentially reduced hydrophobicity in certain domains to maintain flexibility at higher pressures

  • Amino acid substitutions that enhance protein stability under hypoxic conditions

  • Possible modifications in proton-conducting pathways to optimize efficiency during oxygen limitation

When comparing MT-ND4L sequences, researchers should focus on evolutionarily conserved regions versus dive-adapted marine mammals, shallow-diving species, and terrestrial counterparts.

What can we learn from nuclear-encoded MT-ND4L in other species?

In some species, such as the green alga Chlamydomonas reinhardtii, the MT-ND4L gene (called NUO11) has been transferred to the nuclear genome . Studying these nuclear-encoded versions provides valuable insights into:

  • How hydrophobicity is reduced to allow cytoplasmic translation and mitochondrial import

  • Addition of mitochondrial targeting sequences

  • Adaptations in gene expression regulation

For example, in Chlamydomonas, the nuclear-encoded NUO11 shows lower hydrophobicity compared to mitochondrially-encoded counterparts, facilitating its expression and proper mitochondrial import . Similar principles could be applied when designing optimized recombinant expression systems for harbor porpoise MT-ND4L.

What evolutionary insights can harbor porpoise MT-ND4L provide?

Harbor porpoise MT-ND4L represents an excellent model for studying mitochondrial adaptations to the aquatic environment. Research comparing harbor porpoise MT-ND4L with terrestrial relatives can reveal:

  • Signatures of positive selection in regions responsible for energy efficiency

  • Adaptations that may contribute to hypoxia tolerance

  • Conservation patterns indicating functional constraints across diverse environments

These evolutionary insights help understand how mitochondrial function has adapted to the metabolic demands of marine mammal diving physiology.

How can harbor porpoise MT-ND4L serve as a model for mitochondrial disorders?

Harbor porpoise MT-ND4L can provide valuable insights into mitochondrial disorders, particularly those affecting tissues with high energetic demands. In humans, mutations in MT-ND4L have been associated with Leber hereditary optic neuropathy (LHON), characterized by vision loss due to degeneration of retinal ganglion cells . The harbor porpoise MT-ND4L could serve as a comparative model to understand:

  • How sequence variations affect Complex I assembly and function

  • Tissue-specific effects of MT-ND4L mutations

  • Mechanisms of superoxide production in disease states

  • Potential therapeutic approaches for mitochondrial disorders

Researchers can create disease-relevant mutations in recombinant harbor porpoise MT-ND4L (such as the human equivalent of T10663C/Val65Ala) to study functional consequences in reconstituted systems .

What research questions can be addressed using recombinant harbor porpoise MT-ND4L?

Recombinant harbor porpoise MT-ND4L enables investigation of several important research questions:

  • How do marine mammals optimize mitochondrial efficiency during diving?

  • What structural adaptations in Complex I components contribute to hypoxia tolerance?

  • How do variations in MT-ND4L affect superoxide production under different oxygen tensions?

  • What is the role of MT-ND4L in Complex I assembly across diverse mammalian lineages?

  • How do nuclear-mitochondrial genetic interactions influence bioenergetic function in marine mammals?

These questions address fundamental aspects of comparative physiology, mitochondrial biology, and evolutionary adaptation.

What techniques enable targeted mutations in recombinant MT-ND4L?

Creating specific mutations in recombinant harbor porpoise MT-ND4L requires:

  • Site-directed mutagenesis of expression constructs using PCR-based methods

  • Gibson assembly or similar techniques for introducing multiple mutations

  • RNA interference approaches to suppress expression in cellular models, similar to methods used for NUO11 in Chlamydomonas

  • Construction of expression plasmids with selectable markers for stable cell line development

For RNA interference studies, researchers can design constructs similar to the pND4L-RNAi approach described for Chlamydomonas, where gene fragments containing introns are amplified and used to create hairpin RNA structures that trigger silencing of the target gene .

How can researchers verify the authenticity of recombinant MT-ND4L?

Verifying that a recombinant protein is authentic harbor porpoise MT-ND4L (and not a nuclear mitochondrial pseudogene or contamination) requires:

  • Sequencing validation of the expression construct

  • Mass spectrometry confirmation of the purified protein

  • Immunological detection with specific antibodies

  • Functional complementation in MT-ND4L-deficient systems

What are common pitfalls in MT-ND4L research and how can they be avoided?

Common challenges in MT-ND4L research include:

  • Protein aggregation during expression and purification

    • Solution: Use mild detergents and optimize buffer conditions

  • Low expression yields

    • Solution: Employ specialized expression systems for hydrophobic proteins

  • Difficulty distinguishing functional effects of MT-ND4L variants

    • Solution: Develop sensitive assays that isolate specific aspects of Complex I function

  • Challenges in reconstituting functional Complex I

    • Solution: Co-express multiple subunits or use semi-intact membrane systems

  • Contamination with nuclear pseudogenes during gene amplification

    • Solution: Use mitochondria-specific primers and purified mitochondrial DNA as templates

What controls are essential for functional studies of recombinant MT-ND4L?

When conducting functional studies with recombinant harbor porpoise MT-ND4L, essential controls include:

  • Native Complex I from harbor porpoise or closely related species

  • Reconstituted Complex I lacking MT-ND4L

  • Reconstituted Complex I with human or other well-characterized MT-ND4L

  • Appropriate enzyme inhibitors (rotenone, piericidin A) to confirm specific Complex I activity

  • Reactive oxygen species scavengers to validate superoxide measurements

For superoxide production studies in particular, researchers should include appropriate controls to distinguish Complex I-derived superoxide from other sources. Complex I typically produces predominantly superoxide rather than hydrogen peroxide, and the rate of production (about 40 nmol e⁻·min⁻¹·mg⁻¹) represents approximately 1% of the electron transfer to ubiquinone under standard experimental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.