Recombinant Phodopus sungorus Melatonin receptor type 1A (MTNR1A)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant MTNR1A:

PropertyDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, or Cell-Free Expression
Purity≥85% (SDS-PAGE verified)
Molecular WeightFull-length protein (1-353 amino acids) with N-terminal 10xHis tag
SequenceAccession: P49217; includes conserved domains for melatonin binding
Storage-20°C for short-term; -80°C for long-term; avoid repeated freeze-thaw

The recombinant protein retains structural fidelity to the native receptor, critical for functional studies .

Functional Roles and Physiological Significance

MTNR1A mediates melatonin signaling, influencing:

  • Circadian Rhythms: Expressed in brain regions like the suprachiasmatic nucleus (SCN) and cerebellum .

  • Seasonal Reproduction: Regulates photoperiod-dependent reproductive changes in seasonal breeders .

  • Adrenal Signaling: Modulates adrenal gland activity, affecting stress responses and behavior .

Brain Expression Patterns (Transgenic Mouse Models):

Brain RegionExpression LevelMethod
Cerebellum (Purkinje layer)HighFluorescence microscopy
Pars TuberalisModerateImmunohistochemistry
Habenula CommissureModerateDAB staining
Lateral Ventricle EpendymaLowFluorescence microscopy

Data derived from RFP-MT1 transgenic mice highlight receptor localization in circadian and neuroendocrine pathways .

Production and Purification

Recombinant MTNR1A is synthesized using codon-optimized systems:

  • Expression Systems:

    • E. coli: Cost-effective for large-scale production .

    • Mammalian Cells: Ensures proper post-translational modifications .

  • Purification: Affinity chromatography (His-tag) followed by SDS-PAGE validation .

A. Circadian Biology

  • Key Finding: MTNR1A knockdown in Phodopus sungorus disrupts photoperiodic responses, confirming its role in seasonal adaptation .

  • Model Utility: Transgenic mice with RFP-MT1 reporters enable real-time tracking of receptor dynamics .

B. Genetic and Genomic Studies

  • Chromosomal Assembly: The P. sungorus genome (scaffold N50 = 165.75 Mb) provides insights into MTNR1A regulatory elements .

  • Recombination Suppression: X-chromosome inversions in Phodopus species may influence MTNR1A expression patterns .

C. Therapeutic Targeting

  • Lentiviral Delivery: MTNR1A-EGFP fusion constructs enable functional studies in adrenal glands .

Comparative Insights Across Species

SpeciesMTNR1A HomologyFunctional Notes
Human (Homo sapiens)90% amino acid identityRegulates sleep-wake cycles and mood
Sheep (Ovis aries)Polymorphic sitesLinked to litter size and seasonal fertility
Mouse (Mus musculus)96% amino acid identityUsed in circadian behavior models

Challenges and Future Directions

  • Structural Resolution: Crystallization of MTNR1A remains challenging due to transmembrane complexity.

  • In Vivo Dynamics: Role in non-circadian tissues (e.g., adrenal glands) requires further exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
MTNR1A; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)
Target Names
Target Protein Sequence
MKGNGSTLLNASQQAPGVGEGGGPRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKK LRNAGNIFVVSLAIADLVVAIYPYPLVLTSIFNNGWNLGYLHCQISAFLMGLSVIGSIFN ITGIAINRYCYICHSLKYDRLYSNKNSLCYVFLIWVLTLVAIMPNLQTGTLQYDPRIYSC TFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWILVLQVRRRVKPDSKPRLKPQDFRNF VTMFVVFVLFAICWAPLNFIGLIVASDPATMAPRIPEWLFVASYYMAYFNSCLNAIIYGL LNQNFRQEYKRILVSLFTAKMCFVDSSNDPADKIKCKPAPLIANNNLIKVDSV
Uniprot No.

Target Background

Function
Melatonin receptor type 1A (MTNR1A) is a high affinity receptor for melatonin, likely mediating the reproductive and circadian actions of melatonin. This receptor's activity is mediated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
At least in the brain, more precisely in the pars tuberalis and the suprachiasmatic nucleus.

Q&A

How does Phodopus sungorus MTNR1A compare to human MTNR1A?

The Phodopus sungorus MTNR1A shows significant sequence conservation with human MTNR1A, though with some key differences:

FeaturePhodopus sungorus MTNR1AHuman MTNR1A
Amino acid length353350
Chromosomal location-4q35.2
Binding affinity for melatoninSimilar to human receptorIn the picomolar range
Primary signalingGi/Go-mediatedGi/Go-mediated
Secondary signaling-Gq/G11 family pathways

Despite some differences, pharmacological studies have shown that melatonin receptors maintain relatively conserved binding properties across species, suggesting that research findings in hamster models may be translatable to human applications . Both receptors play critical roles in regulating circadian rhythms and metabolic functions.

What are the recommended storage and handling conditions for recombinant MTNR1A?

For optimal stability and activity of recombinant Phodopus sungorus MTNR1A:

  • Store protein at -20°C for regular use, or at -80°C for extended storage

  • Use Tris-based buffer with 50% glycerol (optimized for this specific protein)

  • Avoid repeated freeze-thaw cycles which can compromise protein integrity

  • For working solutions, maintain aliquots at 4°C for up to one week

  • When reconstituting lyophilized protein, use sterile techniques to prevent contamination

What are the recommended approaches for binding studies using recombinant MTNR1A?

Radioligand binding studies can be effectively conducted with recombinant Phodopus sungorus MTNR1A using the following methodology:

  • Membrane preparation:

    • Express the receptor in a suitable cell line (CHO cells have been successfully used)

    • Harvest cells and prepare membrane fractions through differential centrifugation

    • Determine protein concentration using standard assays (Bradford or BCA)

  • Binding assay protocol:

    • Use 2-[125I]-iodomelatonin as the radioligand

    • Perform saturation binding to determine Kd and Bmax values

    • Include non-specific binding controls using excess unlabeled melatonin

    • Incubate at optimal temperature (typically 25°C) for 1-2 hours

    • Terminate binding by rapid filtration

  • Data analysis:

    • Plot specific binding versus radioligand concentration

    • Perform Scatchard analysis or use non-linear regression to determine binding parameters

The reported dissociation constant (Kd) for similar hamster MT1 receptors is approximately 127 pM, with expression levels around 3406 fmol/mg protein when stably expressed in CHO cells . This expression level is notably higher than those reported for rat and human melatonin receptors (80-2650 fmol/mg protein).

How can researchers assess functional activity of recombinant MTNR1A?

Several complementary approaches can be used to evaluate the functional activity of recombinant Phodopus sungorus MTNR1A:

  • cAMP inhibition assay:

    • Since MTNR1A couples primarily to Gi/Go proteins, measure inhibition of forskolin-stimulated cAMP production

    • Use either radioimmunoassay or HTRF-based detection methods

    • Include positive controls (known MT1 agonists) and negative controls

  • G-protein activation studies:

    • Measure [35S]GTPγS binding to assess receptor-mediated G-protein activation

    • Quantify changes in binding upon receptor stimulation with melatonin or synthetic agonists

  • Calcium mobilization:

    • While secondary to the cAMP pathway, MT1 can also couple to Gq/G11 pathways

    • Monitor intracellular calcium changes using fluorescent indicators

  • Electrophysiological studies:

    • Monitor potassium channel activity, which may be modulated downstream of receptor activation

    • Patch-clamp recordings can provide real-time functional readouts

What are the key considerations when designing a heterologous expression system for Phodopus sungorus MTNR1A?

When expressing Phodopus sungorus MTNR1A in heterologous systems, researchers should consider:

  • Expression vector selection:

    • Choose a vector with appropriate promoter strength (CMV or EF1α for mammalian cells)

    • Include epitope tags (His, FLAG, or HA) for detection and purification

    • Consider inducible expression systems if receptor overexpression is toxic

  • Host cell selection:

    • CHO cells have been successfully used for hamster melatonin receptors

    • HEK293 cells provide another reliable mammalian expression system

    • Consider the endogenous G-protein complement of host cells

  • Codon optimization:

    • While not always necessary for hamster-to-mammalian cell expression, codon optimization may improve yields

    • Avoid rare codons that might limit translation efficiency

  • Post-translational modifications:

    • Ensure the host system can perform necessary receptor glycosylation

    • Consider the impact of different cellular environments on receptor trafficking

  • Expression verification:

    • Use Western blotting, flow cytometry, or immunofluorescence to confirm expression

    • Validate receptor functionality through binding and signaling assays

How do MT1 (MTNR1A) and MT2 (MTNR1B) receptors differ in Phodopus sungorus compared to other species?

An important distinction in Phodopus sungorus is the functionality of its melatonin receptors:

SpeciesMT1 (MTNR1A)MT2 (MTNR1B)Key Difference
Phodopus sungorus (Siberian hamster)FunctionalNon-functional pseudogeneMT2 has two nonsense mutations after transmembrane domain IV
Cricetus cricetus (European hamster)FunctionalPotentially functionalHigher sequence conservation
HumanFunctionalFunctionalBoth receptors fully functional
MouseFunctionalFunctionalPharmacological profile similar to human

The Phodopus sungorus MT2 receptor contains truncating mutations that render it non-functional. Two different amplicons have been identified from the Phodopus sungorus retina using 5' RACE techniques, but neither encodes a functional receptor due to frameshift issues potentially caused by intronic conservation .

This unique characteristic of Phodopus sungorus makes it an excellent model for studying MT1-specific physiological functions without MT2 interference, particularly for investigating melatonin's role in seasonal rhythms and reproduction.

What pharmacological tools can differentiate between MTNR1A and other melatonin receptor subtypes?

When conducting pharmacological studies with Phodopus sungorus MTNR1A, researchers can use these selective compounds:

Compound TypeExamplesSelectivity ProfileApplication Notes
MT1-preferring agonistsRamelteonHigher affinity for MT1 than MT2Useful for distinguishing receptor subtypes
MT2-selective agonistsIIK7>100-fold selectivity for MT2Control compound to confirm MT1 specificity
Non-selective antagonistsLuzindoleBlocks both receptor subtypesUseful for general receptor blockade
MT1-selective antagonistsLimited availabilityResearch ongoingImportant area for development

What is the significance of the MTNR1A receptor in metabolic regulation and disease models?

The MTNR1A receptor has emerging significance in metabolic disorders:

  • Glucose homeostasis:

    • Both melatonin receptors (MTNR1A and MTNR1B) are expressed in pancreatic beta cells

    • Receptor activation modulates insulin secretion and glucose metabolism

  • Diabetes research:

    • While MTNR1B is a well-established risk factor for type 2 diabetes (T2D), emerging evidence suggests MTNR1A involvement

    • A study of 212 Italian families with T2D identified three novel MTNR1A variants (rs62350392, rs2119883, and rs13147179) significantly linked to and/or associated with T2D

    • This represents the first report of MTNR1A as a potential risk gene in T2D

  • Circadian rhythm disorders:

    • MTNR1A mediates melatonin's effects on circadian timing

    • Disruption may contribute to sleep disorders and downstream metabolic consequences

This research opens new avenues for investigating the differential roles of melatonin receptor subtypes in metabolic regulation, with Phodopus sungorus providing a useful model system due to its naturally occurring MT2 deficiency .

How can heterodimer formation between MTNR1A and other receptors affect experimental outcomes?

Recent research has revealed important considerations regarding melatonin receptor heteromerization:

  • MT1/MT2 heteromers:

    • In tissues where both receptor subtypes are co-expressed, they can form functional heteromers

    • These heteromers may display unique pharmacological and signaling properties distinct from homomeric receptors

    • Heteromerization affects ligand binding characteristics and downstream signaling cascades

  • Experimental implications:

    • Researchers must consider potential heteromerization when interpreting binding and functional data

    • In species like Phodopus sungorus where MT2 is non-functional, this complexity is reduced

    • For comparative studies with human receptors, heteromer formation may contribute to species differences

  • Detection methods:

    • Techniques such as BRET (Bioluminescence Resonance Energy Transfer) or FRET can be used to detect receptor interactions

    • Co-immunoprecipitation studies with differentially tagged receptors

    • Advanced microscopy techniques to visualize receptor co-localization

Based on studies of MT1/MT2 heteromers in photoreceptor cells, heteromerization likely occurs in multiple tissues where both receptors are co-expressed. This phenomenon may contribute to the diverse physiological effects of melatonin beyond simple activation of individual receptor subtypes .

What are the key considerations for developing MTNR1A knockout or transgenic models?

Researchers developing genetic models involving Phodopus sungorus MTNR1A should consider:

  • Knockout strategy:

    • CRISPR/Cas9 targeting of early exons to ensure complete loss of function

    • Consider conditional knockout approaches if constitutive deletion proves lethal

    • Design genotyping strategies that can distinguish between wild-type, heterozygous, and homozygous animals

  • Phenotypic characterization:

    • Comprehensive assessment of circadian rhythms (activity, body temperature)

    • Detailed metabolic profiling (glucose tolerance, insulin sensitivity)

    • Seasonal responses (reproductive system, body weight, fur color changes)

    • Brain and retinal function (particularly in photoperiodic responses)

  • Compensation mechanisms:

    • In species with functional MT2, compensatory upregulation may occur

    • Phodopus sungorus naturally lacks functional MT2, making it an excellent model for MT1-specific functions

    • Consider developing double knockouts in species with both receptors

  • Control considerations:

    • Use appropriate littermate controls

    • Account for potential off-target effects of gene editing

    • Consider background strain effects on phenotype penetrance

How can contradictory findings between in vitro and in vivo MTNR1A studies be reconciled?

Researchers frequently encounter disparities between in vitro receptor studies and in vivo observations. Key approaches to reconcile such contradictions include:

  • Pharmacokinetic considerations:

    • In vitro binding affinities may not translate directly to in vivo potency

    • Consider drug metabolism, tissue penetration, and protein binding

    • Dosing regimens should account for the short half-life of melatonin

  • Signaling context differences:

    • Cell lines used for in vitro studies may lack the complete signaling machinery present in native tissues

    • The G-protein complement and effector availability differ between systems

    • Heteromerization with other receptors occurs in vivo but may be absent in simplified cell models

  • Methodological approaches:

    • Use multiple cell lines to ensure findings aren't cell-type specific

    • Develop primary cell cultures from target tissues

    • Employ tissue-specific knockout models to validate receptor-specific effects

    • Consider ex vivo approaches (tissue slices) that maintain more native signaling architecture

  • Temporal considerations:

    • Account for circadian time of experiments

    • Melatonin receptor sensitivity exhibits time-dependent variations

    • Acute versus chronic receptor activation may yield different outcomes

What genomic and proteomic approaches could advance understanding of MTNR1A function?

Emerging technologies offer promising approaches to deepen our understanding of MTNR1A:

  • Single-cell transcriptomics:

    • Characterize cell-type specific expression patterns of MTNR1A across tissues

    • Identify co-expressed genes that may function in melatonin signaling networks

    • Study circadian and seasonal variations in receptor expression

  • Proteomics approaches:

    • Identify the complete MTNR1A interactome using proximity labeling techniques

    • Characterize post-translational modifications affecting receptor function

    • Study receptor trafficking dynamics under different physiological conditions

  • CRISPR screening:

    • Identify genes that modulate MTNR1A signaling through genome-wide screens

    • Discover novel components of the melatonin signaling pathway

    • Target pathway elements for therapeutic development

  • Structural biology:

    • Solve the three-dimensional structure of Phodopus sungorus MTNR1A

    • Compare with human receptor structure to guide drug development

    • Investigate conformational changes upon agonist and antagonist binding

How might discoveries regarding Phodopus sungorus MTNR1A translate to human health applications?

Research on Phodopus sungorus MTNR1A has several potential translational implications:

What are the current methodological challenges in MTNR1A research and potential solutions?

Researchers face several persistent challenges when studying MTNR1A:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.