Recombinant Phodopus sungorus Mitochondrial brown fat uncoupling protein 1 (UCP1)

Shipped with Ice Packs
In Stock

Description

Functional Insights

UCP1 facilitates non-shivering thermogenesis by uncoupling mitochondrial proton gradients from ATP synthesis, dissipating energy as heat . Key functional properties include:

PropertyMechanismRegulation
Proton transportActivated by fatty acids; inhibited by purine nucleotides (GDP, ATP) .Requires cardiolipin for structural stability .
Thermogenic activityCritical for cold adaptation in mammals; absent in UCP1-knockout models .Enhanced by adrenergic signaling and mitochondrial membrane potential .
Evolutionary adaptationEvolved from dicarboxylate carriers, retaining symmetric arginine residues for substrate binding .Mutations in substrate-binding site enable proton translocation .

Research Applications

Recombinant UCP1 is pivotal for:

  • Thermogenesis studies: Reconstituted in liposomes to measure proton leak kinetics .

  • Obesity research: Investigating UCP1's role in brown/beige fat activation and energy expenditure .

  • Drug development: Screening compounds that modulate UCP1 activity for metabolic disorders .

Technical Specifications :

ParameterDetails
Host systemE. coli
Purity≥85% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted in Tris/PBS buffer with trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage
SynonymsThermogenin, SLC25A7

Comparative Studies

  • UCP1 vs. UCP2/3: Unlike homologs, UCP1 is uniquely dedicated to thermogenesis and binds purine nucleotides with higher affinity .

  • Species variations: Phodopus sungorus UCP1 shares 85% sequence identity with human UCP1, making it a model for translational studies .

Challenges and Future Directions

  • Mechanistic debates: Whether UCP1 operates via a carrier-like mechanism or channel-like proton leak remains unresolved .

  • Therapeutic potential: Activating UCP1 in human brown/beige fat could combat obesity, but targeted delivery methods are under investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for precise delivery times.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
UCP1; SLC25A7; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)
Target Names
Target Protein Sequence
MVSQTTSEVQPTMGVKIFSAGVAACLADIITFPLDTAKVRLQIQGEGQTSSTIRYKGVLG TITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGKETPPTLVNRISAG LMTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTESLSTLWKGTTPN LLRNVIINCTELVTYDLMKGALVNNQILADDVPCHLLSALVAGFCTTFLASPADVVKTRF INSLPGQYPSVPSCAMTMFTKEGPTAFFKGFVPSFLRLASWNVIMFVCFEQLKKELMKSR QTVDCTT
Uniprot No.

Target Background

Function
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis in response to temperature and diet variations and more broadly to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxidation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Brown adipose tissue.

Q&A

What is UCP1 and what is its primary function in Phodopus sungorus?

UCP1 (Uncoupling Protein 1), also known as thermogenin or solute carrier family 25 member 7, is a mitochondrial protein primarily expressed in brown adipose tissue (BAT) of mammals. In Phodopus sungorus (Djungarian hamster), UCP1 plays a crucial role in non-shivering thermogenesis (NST), a process essential for cold adaptation in this species.

The primary function of UCP1 is to uncouple oxidative phosphorylation by increasing proton conductance across the inner mitochondrial membrane, thereby dissipating the proton motive force as heat rather than ATP synthesis. This mechanism is particularly important for small mammals like the Djungarian hamster, which have a high surface-to-volume ratio and require efficient thermogenic mechanisms to maintain body temperature in cold environments .

How is recombinant Phodopus sungorus UCP1 typically stored and reconstituted?

Recombinant Phodopus sungorus UCP1 requires specific storage and reconstitution protocols to maintain its structural integrity and functional activity:

Storage conditions:

  • Lyophilized form: Stable for approximately 12 months at -20°C/-80°C

  • Liquid form: Stable for approximately 6 months at -20°C/-80°C

  • Working aliquots: Can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C

It is important to note that repeated freezing and thawing is not recommended as it can compromise protein integrity and functionality .

What are the key structural features of UCP1 that enable its uncoupling function?

UCP1 belongs to the mitochondrial carrier family and shares structural similarities with other members of this family. The key structural features that enable its uncoupling function include:

  • Transmembrane domains: UCP1 contains six transmembrane α-helical domains that span the inner mitochondrial membrane, creating a barrel-like structure with a central pore

  • Nucleotide-binding sites: These regions interact with purine nucleotides (particularly GDP) that inhibit UCP1 activity

  • Fatty acid binding sites: Essential for UCP1 activation, as fatty acids serve as physiological activators of the protein

  • Proton-conducting pathway: Specific amino acid residues create a pathway for proton transport across the membrane

The configuration of these structural elements allows UCP1 to function as a regulated proton transporter that can be activated by fatty acids and inhibited by purine nucleotides. This regulation is crucial for controlling thermogenesis in response to physiological stimuli .

How does the uncoupling activity of Phodopus sungorus UCP1 compare with UCP1 from other species, and what are the implications for evolutionary adaptation?

Comparative analysis of UCP1 across species reveals significant insights into evolutionary adaptation of thermogenic mechanisms:

SpeciesUCP1 Expression PatternUncoupling ActivityEvolutionary Significance
Phodopus sungorus (Djungarian hamster)High expression in BAT, cold-inducedHigh, strongly regulated by fatty acids and GDPAdapted for extreme cold environments
Common carp (fish)Expression in liver and brain, cold-suppressed in liver, cold-induced in brainActivatable by palmitate and HNE, inhibited by GDPAncient UCP1 function possibly related to oxidative stress protection rather than thermogenesis
Marsupials (e.g., Sminthopsis crassicaudata)Adipose tissue expression, cold-induced in adultsPresent but less characterizedTransitional evolutionary stage
Monodelphis domestica (opossum)Transient expression during early developmentPresent but less characterizedShows developmental regulation pattern
Eutherians (modern placental mammals)BAT-specific, cold-inducedHigh, strongly regulatedSpecialized for adaptive NST

The biochemical characteristics of carp UCP1 show functional uncoupling that can be activated by fatty acids and inhibited by GDP, similar to mammalian UCP1. This suggests that while the basic molecular mechanism remained conserved, the physiological role shifted from potentially preventing oxidative stress in fish to specialized thermogenesis in mammals .

What methodological approaches are most effective for measuring the uncoupling activity of recombinant Phodopus sungorus UCP1?

Effective methodological approaches for measuring uncoupling activity of recombinant Phodopus sungorus UCP1 include:

  • Polarographic measurements:

    • Measure oxygen consumption rates in isolated mitochondria or reconstituted systems

    • Compare state 4 (non-phosphorylating) respiration rates in the presence and absence of UCP1 activators and inhibitors

    • Equipment: Clark-type oxygen electrode or high-resolution respirometry systems

  • Membrane potential measurements:

    • Use potential-sensitive fluorescent probes (e.g., TMRM, JC-1, Safranin O)

    • Measure changes in membrane potential in response to UCP1 activators (fatty acids) and inhibitors (GDP)

    • Can be performed in isolated mitochondria or reconstituted proteoliposomes

  • Proton leak kinetics:

    • Simultaneous measurement of respiration rate and membrane potential

    • Plot the relationship between these parameters to generate proton leak curves

    • Compare curves under different conditions (e.g., +/- fatty acids, +/- GDP)

  • Microcalorimetry:

    • Direct measurement of heat production

    • Particularly useful for confirming thermogenic function

    • Requires specialized equipment but provides direct evidence of UCP1 function

  • Reconstituted systems:

    • Incorporation of purified recombinant UCP1 into liposomes

    • Allows for controlled studies of UCP1 function without interference from other mitochondrial proteins

    • Useful for studying structure-function relationships

When designing experiments, researchers should include appropriate controls to distinguish UCP1-mediated uncoupling from artifacts or other forms of mitochondrial uncoupling. This typically involves parallel measurements with specific inhibitors of UCP1 (GDP) and other potential uncoupling mechanisms (e.g., inhibitors of the adenine nucleotide translocase) .

How do post-translational modifications affect the function of Phodopus sungorus UCP1, and what techniques can be used to characterize these modifications?

Post-translational modifications (PTMs) significantly impact UCP1 function, though this area remains less explored compared to other aspects of UCP1 biology. Based on current research:

Key PTMs affecting UCP1 function:

  • Phosphorylation:

    • Potential sites include serine and threonine residues

    • May affect protein conformation and interaction with regulatory molecules

    • Can modulate proton conductance activity

  • Glutathionylation:

    • Occurs during oxidative stress conditions

    • May serve as a regulatory mechanism to adjust UCP1 activity in response to redox state

  • Carbonylation:

    • Result of oxidative damage

    • May affect protein stability and function

Techniques for characterizing PTMs in UCP1:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • MALDI-TOF analysis

    • Enables identification of specific modified residues and quantification of modification levels

  • Site-directed mutagenesis:

    • Mutation of potential modification sites

    • Functional assessment of mutants compared to wild-type protein

    • Helps establish the functional significance of specific modifications

  • Phospho-specific antibodies:

    • Western blotting with antibodies that recognize specific phosphorylation sites

    • Allows monitoring of phosphorylation state under different experimental conditions

  • 2D gel electrophoresis:

    • Separation based on both molecular weight and isoelectric point

    • Can resolve different post-translationally modified forms of the protein

  • Proximity ligation assays:

    • Detection of specific PTMs in intact cells or tissues

    • Allows for spatial resolution of modifications

When investigating PTMs in recombinant UCP1, researchers should consider that expression systems may not faithfully reproduce the native pattern of modifications. Comparing recombinant protein with UCP1 isolated from native sources can provide insights into the physiological relevance of observed modifications .

What are the optimal expression systems for producing functional recombinant Phodopus sungorus UCP1?

Selecting an appropriate expression system is critical for obtaining functional recombinant Phodopus sungorus UCP1. Several expression systems have been used with varying degrees of success:

Mammalian expression systems:

  • HEK293 cells: Provide proper post-translational modifications and membrane insertion

  • Chinese Hamster Ovary (CHO) cells: Good for stable expression

  • Advantages: Native-like protein folding, appropriate post-translational modifications

  • Disadvantages: Lower yields, higher cost, more complex cultivation

Yeast expression systems:

  • Saccharomyces cerevisiae: Contains mitochondria for proper targeting

  • Pichia pastoris: Higher protein yields, inducible expression

  • Advantages: Eukaryotic processing, relatively high yields, cost-effective

  • Disadvantages: Glycosylation patterns differ from mammals

Bacterial expression systems:

  • E. coli: Highest yields, simplest cultivation

  • Advantages: Rapid growth, high protein yields, low cost

  • Disadvantages: Lack of post-translational modifications, protein often forms inclusion bodies requiring refolding, potential endotoxin contamination

Cell-free expression systems:

  • Allow for incorporation of modified amino acids

  • Useful for structural studies

  • Advantages: Rapid production, avoid toxicity issues

  • Disadvantages: Lower yields, higher cost, less native-like environment

Based on published research and the product information from the search results, mammalian cell expression systems appear optimal for producing functional recombinant Phodopus sungorus UCP1, as evidenced by the commercial product being sourced from mammalian cells . This likely reflects the need for proper folding and insertion into the mitochondrial membrane to maintain native function.

For functional studies, researchers should verify the activity of recombinant UCP1 using proton leak measurements in reconstituted systems or in isolated mitochondria from cells expressing the recombinant protein .

How can I troubleshoot experiments when recombinant UCP1 shows reduced or no uncoupling activity?

When recombinant Phodopus sungorus UCP1 exhibits reduced or no uncoupling activity, systematic troubleshooting approaches can help identify and resolve the issues:

Common causes of reduced activity and solutions:

  • Protein denaturation or misfolding:

    • Verify protein integrity by SDS-PAGE or native PAGE

    • Optimize purification conditions (detergents, buffer composition)

    • Consider refolding strategies if using bacterial expression systems

    • Use circular dichroism to assess secondary structure

  • Improper reconstitution:

    • Check pH and ionic strength of reconstitution buffer

    • Optimize protein-to-lipid ratio in proteoliposome preparations

    • Ensure proper orientation in the membrane (right-side-out)

    • Verify incorporation efficiency using density gradient centrifugation

  • Absence of essential cofactors:

    • Add free fatty acids (e.g., palmitate) as activators

    • Test different fatty acid species and concentrations

    • Ensure cofactors are not oxidized or degraded

  • Presence of inhibitors:

    • Check for purine nucleotide contamination in reagents

    • Wash preparations thoroughly to remove potential inhibitors

    • Test for inhibition by specific compounds (GDP, ATP)

  • Inappropriate assay conditions:

    • Optimize temperature (typically 25-37°C for mammalian UCP1)

    • Adjust pH (usually 7.2-7.4 is optimal)

    • Ensure appropriate substrate concentrations

    • Verify assay sensitivity using positive controls

Systematic troubleshooting approach:

  • Begin with positive controls using natural UCP1 from BAT mitochondria

  • Compare activity under identical conditions

  • Sequentially modify single variables to identify critical factors

  • Consider species-specific differences that might affect activity requirements

Validation experiments:

  • Confirm UCP1 inhibition by GDP (characteristic of UCP1 function)

  • Verify fatty acid activation (another hallmark of UCP1)

  • Test sensitivity to known UCP1 modulators like 4-hydroxy-trans-2-nonenal (HNE)

If troubleshooting fails to restore activity, consider investigating whether the specific UCP1 isoform from Phodopus sungorus has unique regulatory requirements compared to more extensively studied species .

How does UCP1 expression and regulation in Phodopus sungorus differ from other species across varying environmental conditions?

UCP1 expression and regulation show distinct patterns across species, with Phodopus sungorus demonstrating specific adaptations to its environmental niche:

SpeciesPrimary UCP1 Expression SitesCold ResponseSeasonal RegulationOther Regulatory Factors
Phodopus sungorus (Djungarian hamster)Brown adipose tissueStrong upregulationPhotoperiod-sensitive, higher in winterDiet, age, reproductive status
Common carp (fish)Liver, brainDownregulation in liver, upregulation in brainTemperature-dependentUnknown
Elephantulus myurus (Rock elephant shrew)Brown adipose tissuePresent but less adaptiveLess seasonal variationUnknown
Sminthopsis crassicaudata (Fat-tailed dunnart, marsupial)Adipose tissueUpregulationPresent in adultsUnknown
Monodelphis domestica (Gray short-tailed opossum)Adipose tissueUnknownTransient expression restricted to early developmentDevelopmental stage
Modern eutherian mammalsBrown adipose tissueStrong upregulationSpecies-dependentDiet, age, reproductive status

The Djungarian hamster (Phodopus sungorus) shows particularly robust cold-induced UCP1 expression in BAT, which aligns with its evolutionary adaptation to extreme cold environments. This species also exhibits strong photoperiodic regulation of UCP1, with increased expression during short day conditions that mimic winter.

The evolutionary comparison reveals that while the uncoupling function of UCP1 appears conserved across vertebrates, its physiological role has shifted from potentially protecting against oxidative stress in fish to specialized thermogenesis in mammals, particularly in species adapted to cold environments like Phodopus sungorus .

What unique experimental considerations should be taken into account when comparing UCP1 from Phodopus sungorus with UCP1 from other species?

When conducting comparative studies of UCP1 across species, researchers should consider several key experimental factors to ensure valid comparisons:

1. Sequence and structural differences:

  • Perform sequence alignments to identify conserved and variable regions

  • Consider differences in key functional domains (nucleotide-binding sites, fatty acid interaction sites)

  • Account for species-specific post-translational modifications

  • Analyze phylogenetic relationships to inform experimental design

2. Expression system considerations:

  • Use identical expression systems for fair comparisons

  • Consider the HEK293 cell system established for mouse UCP1, which demonstrates native function in isolated mitochondria

  • Ensure comparable protein folding and membrane insertion across species

3. Functional assay standardization:

  • Maintain identical assay conditions (temperature, pH, substrate concentrations)

  • Use equivalent concentrations of activators and inhibitors

  • Normalize for protein expression levels

  • Consider species-optimal temperatures for activity measurements

4. Tissue-specific differences:

  • Account for differing tissue expression patterns (e.g., fish UCP1 in liver vs. mammalian UCP1 in BAT)

  • Consider tissue-specific regulatory mechanisms when interpreting results

5. Evolutionary context:

  • Consider evolutionary distance when comparing species (e.g., fish vs. mammals)

  • Use appropriate evolutionary models in phylogenetic analyses

  • Account for differing selective pressures on UCP1 across lineages

6. Physiological relevance:

  • Correlate in vitro findings with in vivo physiological contexts

  • Consider the natural habitat and thermal challenges of each species

  • Account for whole-organism adaptations that may influence UCP1 function

A particularly valuable approach is to utilize a standardized cellular system where different UCP orthologues can be compared in an identical mitochondrial and genetic background. Research has established such a system using cell lines ectopically expressing mouse UCP1, which could be adapted for Phodopus sungorus UCP1 comparative studies .

What are the emerging techniques for studying UCP1 function, and how might they be applied to Phodopus sungorus UCP1 research?

Emerging techniques are expanding our ability to understand UCP1 function at multiple levels. These approaches offer new opportunities for Phodopus sungorus UCP1 research:

1. Advanced imaging techniques:

  • Cryo-electron microscopy (Cryo-EM): Enables high-resolution structural analysis of UCP1 in its native membrane environment

  • Super-resolution microscopy: Allows visualization of UCP1 distribution within mitochondria at nanoscale resolution

  • FRET-based sensors: Can detect conformational changes in UCP1 during activation/inhibition

  • Application to P. sungorus: Could reveal species-specific structural features that contribute to cold adaptation

2. Genome editing approaches:

  • CRISPR/Cas9 technology: Enables precise modification of UCP1 gene in various model systems

  • Knock-in of reporter tags: Allows real-time monitoring of UCP1 expression and localization

  • Application to P. sungorus: Could create models with tagged or modified UCP1 to study regulation in vivo

3. Single-cell technologies:

  • Single-cell RNA sequencing: Reveals cell-to-cell variability in UCP1 expression

  • Single-cell proteomics: Detects variations in UCP1 protein levels and modifications

  • Application to P. sungorus: Could identify previously unknown BAT cell subpopulations with unique UCP1 regulation patterns

4. Organoid and tissue engineering:

  • Brown adipose tissue organoids: Three-dimensional in vitro models that recapitulate in vivo tissue architecture

  • Engineered BAT constructs: Can be used for functional studies and potential therapeutic applications

  • Application to P. sungorus: Could provide an ex vivo system to study environmental influences on UCP1 regulation

5. Multi-omics integration:

  • Integration of genomics, transcriptomics, proteomics, and metabolomics data: Provides comprehensive view of UCP1 regulation

  • Network analysis: Identifies key regulatory hubs controlling UCP1 expression and function

  • Application to P. sungorus: Could reveal species-specific regulatory networks underlying cold adaptation

6. In situ hybridization with anatomical precision:

  • RNAscope and related technologies: Allow precise localization of UCP1 mRNA in tissue sections

  • Application to P. sungorus: Could map UCP1 expression patterns across tissues with high sensitivity, similar to the approach used for carp UCP1 brain distribution

These emerging techniques could significantly advance our understanding of the unique adaptations of Phodopus sungorus UCP1, particularly in the context of its exceptional cold tolerance and seasonal adaptation mechanisms.

What is the current understanding of the evolutionary relationship between UCP1 in Phodopus sungorus and other vertebrates, and what research questions remain unresolved?

Our current understanding of the evolutionary relationships of UCP1 across vertebrates, including Phodopus sungorus, reveals a complex history with several unresolved questions:

Current evolutionary understanding:

  • Ancient origin: Phylogenetic analyses suggest UCP1 diverged before UCP2 and UCP3 separated, indicating an ancient origin dating back to at least the evolutionary stage of teleost fish (approximately 420 million years ago) .

  • Functional divergence: While the basic uncoupling mechanism appears conserved (activation by fatty acids, inhibition by GDP), the physiological role has diverged significantly:

    • In fish: Expressed in liver and brain, potentially involved in protection from oxidative stress

    • In marsupials: Expressed in adipose tissue, with evidence of cold-induction in some species

    • In eutherians including Phodopus sungorus: Specialized for thermogenesis in BAT

  • Variable selection pressure: The elongated branch lengths within the UCP1 group suggest different selection pressures compared to UCP2 and UCP3, which show more conserved evolution across vertebrates .

  • Adaptive significance: The presence of UCP1-dependent thermogenesis appears to have evolved gradually, with full adaptive non-shivering thermogenesis (NST) becoming prominent in small-bodied eutherian mammals like Phodopus sungorus.

Unresolved research questions:

  • Molecular basis of functional differences: What specific amino acid changes led to the functional shift from potential antioxidant roles in fish to thermogenesis in mammals?

  • Regulatory evolution: How did the tissue-specific and cold-responsive regulatory elements of the UCP1 gene evolve?

  • Convergent evolution: Have other thermogenic mechanisms evolved in lineages that lost or never had UCP1-mediated thermogenesis?

  • Species-specific adaptations: What molecular features make Phodopus sungorus UCP1 particularly effective for its extreme cold environment compared to other mammalian species?

  • Ancestral function: What was the original function of UCP1 before its specialization for thermogenesis?

  • Selective pressures: What environmental or physiological factors drove the evolution of UCP1-mediated thermogenesis in mammals?

  • Physiological role in non-BAT tissues: What is the significance of UCP1 expression in tissues other than BAT across different species?

  • Evolutionary timing: When did UCP1 acquire its thermogenic function during mammalian evolution?

Addressing these questions will require integrated approaches combining comparative genomics, biochemical characterization of UCP1 from diverse species, and physiological studies across the vertebrate phylogeny. The study of species with extreme adaptations, like Phodopus sungorus, provides particularly valuable insights into the evolutionary processes that shaped UCP1 function .

What are the best practices for designing experiments using recombinant Phodopus sungorus UCP1?

Based on the available research and product information, the following best practices are recommended for experiments using recombinant Phodopus sungorus UCP1:

Experimental design recommendations:

  • Protein handling:

    • Store recombinant UCP1 properly (-20°C/-80°C with 50% glycerol for long-term storage)

    • Minimize freeze-thaw cycles by creating appropriate aliquots

    • Centrifuge vials before opening to collect protein at the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Quality control:

    • Verify protein integrity using SDS-PAGE before experiments

    • Confirm identity using Western blot with specific antibodies

    • Assess purity (should be >85% as indicated for the commercial product)

    • Verify functional activity before complex experiments

  • Experimental controls:

    • Include positive controls (e.g., natural UCP1 from BAT)

    • Include negative controls (e.g., heat-denatured protein)

    • Use paired inhibitor experiments (GDP) to confirm UCP1-specific effects

    • Consider species-matched controls when possible

  • Functional assays:

    • Test multiple fatty acid species and concentrations for activation

    • Include GDP inhibition controls

    • Optimize temperature conditions (considering the natural habitat of P. sungorus)

    • Consider using multiple complementary assay methods

  • Cell-based systems:

    • Consider established cell systems for heterologous expression

    • Use cell lines with minimal endogenous UCP expression

    • Include appropriate vector-only controls

    • Verify mitochondrial targeting and incorporation

  • Data interpretation:

    • Consider the partial nature of the commercial recombinant protein when interpreting results

    • Account for potential differences from the native protein

    • Compare with published data on UCP1 from other species

    • Consider evolutionary context when interpreting functional differences

  • Reporting standards:

    • Document detailed methods including source of recombinant protein

    • Report exact buffer compositions and experimental conditions

    • Include raw data alongside normalized results

    • Specify specific isoform and source organism in all reports

Following these best practices will help ensure reproducible and reliable results when working with recombinant Phodopus sungorus UCP1, contributing to our understanding of this important protein's function and evolution.

What are the most significant research gaps in our understanding of Phodopus sungorus UCP1, and how might they be addressed?

Despite advances in UCP1 research, several significant knowledge gaps remain regarding Phodopus sungorus UCP1. Addressing these gaps requires targeted research approaches:

Significant research gaps and proposed approaches:

  • Complete structural characterization:

    • Gap: High-resolution structure of P. sungorus UCP1 is lacking

    • Approach: Apply cryo-EM or X-ray crystallography to purified protein

    • Significance: Would reveal species-specific structural adaptations for extreme cold environments

  • Species-specific regulation mechanisms:

    • Gap: Molecular basis for the exceptional cold-sensitivity of P. sungorus UCP1 expression

    • Approach: Comparative promoter analysis, ChIP-seq for transcription factors, transgenic models

    • Significance: Could identify unique regulatory elements with potential therapeutic applications

  • Post-translational modification landscape:

    • Gap: Comprehensive characterization of PTMs and their functional significance

    • Approach: Advanced proteomics, site-directed mutagenesis, in vivo modification studies

    • Significance: May reveal novel regulatory mechanisms specific to extreme cold adaptation

  • Interaction with other uncoupling proteins:

    • Gap: Potential functional interactions between UCP1 and other UCPs (UCP2, UCP3)

    • Approach: Co-expression studies, co-immunoprecipitation, proximity labeling techniques

    • Significance: Could reveal synergistic or compensatory mechanisms in thermogenic tissues

  • Tissue-specific functions beyond BAT:

    • Gap: Potential roles of UCP1 in non-canonical tissues in P. sungorus

    • Approach: Tissue-specific expression analysis, conditional knockout models

    • Significance: May uncover novel functions beyond thermogenesis

  • Seasonal adaptation mechanisms:

    • Gap: Molecular basis for seasonal changes in UCP1 function and regulation

    • Approach: Longitudinal studies across seasons, photoperiod manipulation experiments

    • Significance: Would enhance understanding of environmental adaptation mechanisms

  • Comparative effectiveness of different fatty acid activators:

    • Gap: Species-specific preferences for different fatty acid species

    • Approach: Systematic testing of fatty acid panels, binding studies, molecular modeling

    • Significance: Could identify optimal activators for experimental and potential therapeutic applications

  • Integration with whole-body metabolism:

    • Gap: How P. sungorus UCP1 activity coordinates with whole-body metabolic adaptations

    • Approach: Integrative physiology studies, metabolomics, in vivo imaging

    • Significance: Would place UCP1 function in broader physiological context

  • Developmental regulation:

    • Gap: Ontogeny of UCP1 expression and function in P. sungorus

    • Approach: Developmental time-course studies, embryonic and postnatal analyses

    • Significance: Could reveal critical developmental windows for thermogenic adaptation

Addressing these research gaps would significantly advance our understanding of how Phodopus sungorus has adapted its UCP1 system for survival in extreme cold environments, with potential implications for human metabolic research and therapeutic applications targeting brown fat activation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.