Recombinant Phodopus sungorus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Research Applications

While specific studies using the Phodopus sungorus variant are not detailed in the provided sources, its homologs in humans and other species highlight potential applications:

  • Enzyme Activity Assays: Study NADH dehydrogenase function and electron transport kinetics .

  • Structural Studies: Analyze transmembrane domain interactions within Complex I .

  • Disease Modeling: Investigate mitochondrial disorders like Leigh syndrome or MELAS linked to MT-ND3 mutations .

  • Antibody Development: Commercial antibodies (e.g., ab204977) target human MT-ND3, suggesting utility in cross-species epitope validation .

Pathological and Clinical Relevance

Although derived from Phodopus sungorus, insights from human MT-ND3 studies are instructive:

  • Mutations: Pathogenic variants (e.g., 10197G>A) disrupt Complex I activity, causing neurodegenerative disorders like Leigh syndrome .

  • Functional Impact: Subunit disruptions impair proton pumping and ATP synthesis, leading to bioenergetic deficits .

Limitations and Future Directions

Current data gaps include:

  • Structural Resolution: No crystal or cryo-EM structures for the Phodopus variant.

  • In Vivo Studies: Lack of published research on this specific recombinant protein in disease models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a 12-month shelf life when stored at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preference for a particular tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)
Target Names
Target Protein Sequence
MNLMLTLITNISLSLVLITVAFWLPQLNVYTEKASPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAMQSTNLTMTLTFSFLFLTILALGLAYEWKQKGLEWTE
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It plays a vital role in the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in Phodopus sungorus?

MT-ND3 (Mitochondrially encoded NADH:ubiquinone oxidoreductase chain 3) is a critical component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain, essential for cellular energy production through oxidative phosphorylation. In Phodopus sungorus (Djungarian hamster), this protein is encoded by the mitochondrial genome and plays a fundamental role in the assembly and function of Complex I, which is the first enzyme in the electron transport chain . The protein consists of 115 amino acids and functions within the inner mitochondrial membrane, where it participates in proton pumping across the membrane, contributing to the electrochemical gradient necessary for ATP synthesis . MT-ND3 in Phodopus sungorus is particularly interesting due to the species' well-documented seasonal physiological changes, including reproductive cycles that are influenced by photoperiod and involve mitochondrial regulation mechanisms . Research suggests that MT-ND3, along with other mitochondrial components, may undergo seasonal regulation that correlates with changes in energy metabolism and reproductive function in these animals.

The functional importance of MT-ND3 becomes evident when examining pathological conditions associated with its mutation. Deficiencies or structural alterations in MT-ND3 can compromise Complex I assembly and activity, leading to reduced ATP production and mitochondrial dysfunction . This protein's conservation across species highlights its evolutionary importance in maintaining proper mitochondrial function, making it a valuable research target for understanding both basic mitochondrial biology and pathological conditions associated with energy metabolism disorders.

What structural characteristics define MT-ND3 in Phodopus sungorus?

The MT-ND3 protein in Phodopus sungorus exhibits specific structural features that facilitate its integration into Complex I and support its functional role in the mitochondrial respiratory chain. The full amino acid sequence of MT-ND3 in Phodopus sungorus is "MNLmLTLITNISLSLVLITVAFWLPQLNVYTEKASPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAMQSTNLTMTLTFSFLFLTILALGLAYEWKQKGLEWTE," comprising 115 amino acids that form a predominantly hydrophobic protein with multiple transmembrane domains . This hydrophobic nature enables MT-ND3 to embed within the inner mitochondrial membrane, where it interacts with other Complex I subunits to maintain the structural integrity of the enzyme complex and support electron transfer functions . When comparing the amino acid sequence of MT-ND3 across species, such as between Phodopus sungorus and Sigmodon ochrognathus (Yellow-nosed cotton rat), researchers can observe evolutionary conservation in functionally critical regions while noting species-specific variations that may relate to ecological adaptations .

The protein's structure includes specific domains that contribute to its integration within Complex I and its functional capacity. These structural elements include transmembrane helices that anchor the protein within the membrane and exposed regions that facilitate interactions with other Complex I subunits . Research has demonstrated that the absence of ND3 prevents the assembly of the 950-kDa whole Complex I and suppresses the enzyme activity, highlighting the critical structural role this small protein plays in mitochondrial function . The three-dimensional configuration of MT-ND3 within Complex I creates channels for proton translocation, contributing to the protein's role in energy transduction during oxidative phosphorylation.

How does MT-ND3 contribute to seasonal physiological changes in Phodopus sungorus?

MT-ND3 in Phodopus sungorus exists within a complex regulatory network that mediates seasonal physiological adaptations, particularly in reproductive function and energy metabolism. Research has demonstrated that Siberian hamsters undergo substantial physiological changes in response to photoperiod (day length), including alterations in body mass, reproductive organ size, and metabolic rate, with mitochondrial proteins like MT-ND3 playing regulatory roles in these processes . Specifically, these hamsters show decreased body and uterine mass after exposure to short day (SD) lengths for 10 weeks, accompanied by altered expression of neuroendocrine factors that regulate seasonal reproduction . The mitochondrial function, including the activity of Complex I containing MT-ND3, appears to be modulated seasonally to accommodate changing energetic demands associated with reproduction and thermoregulation in these animals.

The regulation of MT-ND3 appears to be influenced by thyroid hormone signaling, particularly triiodothyronine (T3), which has been implicated in the initiation of breeding in many seasonally reproductive species . Research examining the effect of T3 on photoperiod-dependent regulation of reproductive physiology in female Siberian hamsters suggests complex hormonal interactions that may ultimately influence mitochondrial function through proteins like MT-ND3 . Additionally, epigenetic modifications, including DNA methylation, vary across seasonal reproductive states and may contribute to the regulation of mitochondrial gene expression . The expression of DNA methyltransferases (Dnmts) shows photoperiod-dependent changes in the hypothalamus, suggesting that epigenetic mechanisms may contribute to the seasonal regulation of mitochondrial function, potentially affecting MT-ND3 expression or activity.

What experimental methods are optimal for studying MT-ND3 function in vivo?

For functional assessment of MT-ND3's role in Complex I activity, researchers commonly employ spectrophotometric assays that measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria or tissue homogenates . Additionally, oxygen consumption measurements using high-resolution respirometry provide insights into the functional consequences of MT-ND3 alterations on mitochondrial respiratory capacity . ATP synthesis rates can be quantified using luminescence-based assays to evaluate the impact of MT-ND3 variants on energy production capacity . For tissue-specific or cellular localization studies, immunohistochemistry or immunofluorescence with confocal microscopy enables visualization of MT-ND3 distribution within tissues or cells, particularly when studying the protein's involvement in seasonal physiological changes in specific brain regions like the hypothalamus in Phodopus sungorus .

Research on MT-ND3 function can also benefit from innovative approaches such as transmitochondrial cybrid models, where mitochondria harboring specific MT-ND3 variants are introduced into cells depleted of mitochondrial DNA, allowing for controlled study of variant effects in a consistent nuclear background . Additionally, CRISPR-based mitochondrial DNA editing techniques, though still developing, offer potential for precise manipulation of MT-ND3 sequences to study structure-function relationships. These complementary methodologies provide a comprehensive toolkit for investigating MT-ND3's role in mitochondrial biology and disease mechanisms.

How do MT-ND3 variants impact mitochondrial function in disease models?

MT-ND3 variants have been extensively studied in disease models, particularly in relation to Leigh syndrome and mitochondrial complex I deficiency, revealing significant impacts on mitochondrial function through multiple pathogenic mechanisms. Recent research has identified specific nucleotide changes in MT-ND3, including m.10197G>C and m.10191T>C, which are associated with Leigh syndrome, a severe neurological disorder characterized by progressive loss of motor and cognitive abilities . Functional analyses of these variants demonstrate that they significantly lower MT-ND3 protein levels, resulting in Complex I assembly defects, reduced enzyme activity, and diminished ATP synthesis capacity . The pathogenicity of these variants stems from their location within functionally critical regions of the MT-ND3 protein, disrupting interactions with other Complex I subunits and compromising the structural integrity of the entire complex.

The impact of MT-ND3 variants on mitochondrial function shows correlation with mutant load (the percentage of mitochondrial DNA molecules carrying the mutation), though this relationship can be complex and tissue-dependent . Research on patients with m.10191T>C mutations showed mutant loads ranging from 57.9% to 93.6%, with varying clinical manifestations . Interestingly, no particular correlation was observed between mutant load and the onset of first symptoms or seizures in these patients, suggesting that additional factors likely influence phenotypic expression . The complexity of genotype-phenotype relationships in MT-ND3-related diseases highlights the need for comprehensive approaches in studying these conditions.

Beyond structural impacts on Complex I, MT-ND3 variants also lead to functional consequences including increased reactive oxygen species (ROS) production, altered mitochondrial membrane potential, and compromised mitochondrial dynamics . These secondary effects can trigger cellular stress responses and contribute to tissue damage, particularly in high-energy demanding tissues like the brain, explaining the neurological manifestations common in patients with MT-ND3 mutations . The association between MT-ND3 mutations and epilepsy is particularly strong, with research showing that six out of seven patients with m.10191T>C mutations were diagnosed with epilepsy, and three of these developed Lennox-Gastaut syndrome, a severe form of epilepsy characterized by multiple seizure types .

What methodologies are available for rescuing MT-ND3 deficiencies in experimental models?

Research has developed several innovative strategies for rescuing MT-ND3 deficiencies, with allotopic expression representing one of the most promising approaches for addressing mitochondrial protein defects. This technique involves re-engineering mitochondrial genes for nuclear expression through codon optimization, followed by targeting the synthesized proteins to mitochondria . The approach overcomes the genetic code differences between nuclear and mitochondrial systems by adapting the mitochondrial gene sequence to conform to the universal genetic code used in the nucleus and cytoplasmic translation machinery . For MT-ND3 specifically, researchers construct expression vectors containing the codon-optimized MT-ND3 sequence fused with mitochondrial targeting sequences that direct the protein to mitochondria after cytoplasmic synthesis .

The implementation of this strategy involves several critical methodological steps, beginning with PCR amplification of the MT-ND3 sequence using specific primers containing appropriate restriction sites for vector construction . For instance, researchers have designed primers such as ND3-3F (5′-ATCGATAAGCTTCAGCAGTACGTGCGCGAGCA-3′) and ND3-2R (5′-AAGCTTCCATGGCGTGCGTCATGGCGTAGGGG-3′) containing ClaI, HindIII, or NcoI restriction sites to facilitate cloning into expression vectors . Following successful cloning and transformation into expression hosts, the recombinant proteins are purified and characterized before functional testing . The efficacy of this approach has been demonstrated in patients with m.10197G>C and m.10191T>C missense variants in MT-ND3, where nuclear expression of the codon-optimized gene partially restored protein levels, ameliorated Complex I deficiency, and significantly improved ATP production .

How should researchers design experiments to study MT-ND3 expression patterns in Phodopus sungorus?

Designing experiments to study MT-ND3 expression patterns in Phodopus sungorus requires careful consideration of the species' unique seasonal physiology and the technical challenges associated with mitochondrial protein analysis. A comprehensive experimental design should incorporate multiple time points across seasonal transitions, particularly focusing on the shift between long-day (LD) and short-day (SD) photoperiods, which trigger significant physiological changes in these animals . Researchers should maintain controlled environmental conditions, standardizing temperature, humidity, food availability, and precise photoperiod parameters (typically 16L:8D for long days and 8L:16D for short days) to isolate the effects of photoperiod on MT-ND3 expression . Sample collection protocols should include multiple tissues, with particular attention to brain regions like the hypothalamus that regulate seasonal responses, as well as peripheral tissues with high energy demands that might show significant mitochondrial adaptations.

Quantification of MT-ND3 expression requires a multi-level approach examining both transcriptomic and proteomic aspects. At the transcript level, quantitative PCR with primers specific to the MT-ND3 gene provides a foundation for expression analysis, while RNA sequencing offers a broader perspective on mitochondrial transcriptome changes . Protein-level analysis should employ western blotting with validated antibodies against MT-ND3, complemented by mass spectrometry-based proteomics for unbiased protein quantification . Critical controls must include reference genes or proteins that remain stable across photoperiodic conditions, validation across multiple biological replicates, and comparison with other mitochondrial and nuclear-encoded components of Complex I to distinguish MT-ND3-specific effects from general mitochondrial responses.

Experimental designs should also account for potential confounding factors that might influence MT-ND3 expression, including sex differences, age, and previous photoperiodic history . The incorporation of pharmacological interventions, such as thyroid hormone administration, can help elucidate regulatory mechanisms, as demonstrated by studies examining the effect of triiodothyronine (T3) on neuroendocrine regulation in Siberian hamsters . Additionally, epigenetic analysis, particularly of DNA methylation patterns, can provide insights into regulatory mechanisms, given the observed photoperiod-dependent changes in DNA methyltransferase expression in these animals . This multi-faceted approach enables comprehensive characterization of MT-ND3 expression patterns and their relationship to seasonal physiological adaptations.

What are the challenges in working with recombinant MT-ND3 and how can they be addressed?

Working with recombinant MT-ND3 presents several significant challenges due to its hydrophobic nature, mitochondrial origin, and functional dependence on integration into Complex I. The protein's high hydrophobicity, evident from its amino acid sequence containing multiple transmembrane domains, creates difficulties in expression, solubilization, and purification processes . When expressed in heterologous systems like E. coli, MT-ND3 often forms inclusion bodies or aggregates, compromising yield and functional integrity . Researchers can address this challenge by optimizing expression conditions, including temperature reduction to 16-18°C during induction, using specialized E. coli strains designed for membrane protein expression, or employing fusion tags that enhance solubility such as thioredoxin, SUMO, or GST . Additionally, detergent selection becomes critical during purification, with mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or digitonin often providing the best balance between solubilization efficiency and protein stability.

Another significant challenge involves ensuring proper folding and functional activity of the recombinant protein, particularly since MT-ND3 normally functions as part of a large multi-subunit complex . Isolated MT-ND3 may not adopt its native conformation or exhibit typical functional characteristics when separated from its Complex I partners . Researchers can partially address this by co-expressing MT-ND3 with interacting Complex I subunits or reconstructing minimal functional units containing critical interacting partners . Alternatively, developing assays that specifically measure MT-ND3's contribution to Complex I assembly rather than direct enzymatic activity can provide valuable functional data without requiring fully assembled complexes .

Storage and stability represent additional challenges, as purified MT-ND3 can rapidly lose structural integrity and functional activity . Standard protocols recommend storage in buffers containing glycerol (typically 50%) to prevent freeze-thaw damage, maintaining samples at -20°C/-80°C for long-term storage, and avoiding repeated freeze-thaw cycles . For working solutions, keeping aliquots at 4°C for up to one week minimizes degradation . Additionally, incorporating stabilizing agents such as trehalose (6%) in storage buffers can significantly enhance protein stability, as demonstrated in protocols for recombinant Sigmodon ochrognathus MT-ND3 . These methodological adaptations collectively enhance the feasibility of working with this challenging but important mitochondrial protein.

How can researchers effectively measure MT-ND3 integration into Complex I?

Effectively measuring MT-ND3 integration into Complex I requires specialized techniques that can detect and quantify the protein's incorporation into the fully assembled complex while distinguishing between assembly intermediates and complete complex formation. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) represents the gold standard technique for this purpose, allowing separation of intact respiratory chain complexes according to their molecular weight while preserving their native state and protein-protein interactions . Following BN-PAGE, researchers can perform western blotting with antibodies against MT-ND3 and other Complex I subunits to visualize the distribution of MT-ND3 across assembly intermediates and the fully assembled 950-kDa complex . The absence of MT-ND3 signal in the fully assembled complex band, coupled with accumulation in lower molecular weight intermediates, indicates assembly defects, while normal distribution suggests proper integration .

Complementary to electrophoretic techniques, immunoprecipitation assays can provide direct evidence of protein-protein interactions between MT-ND3 and other Complex I subunits . By using antibodies against known interacting partners of MT-ND3 within Complex I, researchers can co-precipitate MT-ND3 and confirm its physical association with the complex . Additionally, proximity labeling techniques such as BioID or APEX2, where an enzymatic tag fused to a known Complex I subunit labels proteins in close proximity including properly integrated MT-ND3, offer spatial resolution of protein interactions within the complex . These techniques can be particularly valuable when studying the effects of MT-ND3 variants on complex assembly, as they can reveal subtle changes in interaction patterns that might not be apparent in BN-PAGE analysis.

Functional assays provide indirect but physiologically relevant measures of MT-ND3 integration by assessing Complex I activity, which depends on proper assembly of all subunits including MT-ND3 . Spectrophotometric measurement of NADH:ubiquinone oxidoreductase activity in isolated mitochondria or membrane preparations can reveal functional deficits associated with improper MT-ND3 integration . Research has demonstrated that the absence of ND3 prevents the assembly of the whole Complex I and suppresses enzyme activity, establishing a clear link between MT-ND3 integration and functional outcomes . By combining structural analysis through BN-PAGE and immunoprecipitation with functional assessment of Complex I activity, researchers can comprehensively evaluate MT-ND3 integration and its consequences for mitochondrial function.

How should researchers interpret changes in MT-ND3 expression in different physiological states of Phodopus sungorus?

Interpreting changes in MT-ND3 expression across physiological states in Phodopus sungorus requires contextualizing these changes within the broader framework of seasonal adaptation and energy metabolism regulation. Researchers should first establish reliable baseline expression levels across multiple reference tissues and time points, accounting for natural variation unrelated to the physiological transitions of interest . Statistical approaches should include repeated measures analysis for longitudinal studies tracking animals across seasonal transitions, with mixed-effects models that can account for individual variation while detecting consistent patterns across the population . When analyzing photoperiod effects specifically, comparing LD (long day) versus SD (short day) groups using t-tests or ANOVA with appropriate post-hoc tests can identify significant differences, while correlation analyses can reveal relationships between MT-ND3 expression and other physiological parameters such as reproductive organ weights, body mass, or hormone levels .

What are the best practices for analyzing mutant load in MT-ND3 variant studies?

Analyzing mutant load in MT-ND3 variant studies requires sophisticated quantitative approaches to accurately determine the proportion of mutant mtDNA molecules and establish meaningful correlations with phenotypic outcomes. Next-generation sequencing (NGS) represents the gold standard for quantifying heteroplasmic mutant load, as it allows for individual sequencing of each DNA template and precise counting of the number of mtDNA reads containing wild-type versus mutant sequences . When implementing NGS-based quantification, researchers should ensure adequate sequencing depth (typically >1000x coverage) to achieve statistical confidence in heteroplasmy estimates, particularly for low-level variants . The sequence data should be mapped to the human mitochondrial reference genome (e.g., NC_012920) using appropriate alignment tools such as Burrows-Wheeler Aligner, followed by variant identification using platforms like the Genome Analysis Toolkit with careful filtering using quality parameters to minimize false positives .

Statistical analysis of mutant load data should incorporate correlation studies to examine relationships between mutant percentage and clinical or biochemical phenotypes. Pearson correlation coefficients can assess linear relationships between continuous variables such as mutant load and age of symptom onset, while non-parametric alternatives like Spearman's rank correlation may be more appropriate for non-linear relationships or small sample sizes . Studies of patients with m.10191T>C mutations have revealed varying correlations between mutant load and clinical parameters (r = 0.470, p = 0.347 for relationship between first symptom onset and first seizure; r = 0.523, p = 0.287 for first symptom onset and mutant load; r = 0.374, p = 0.465 for first seizure onset and mutant load), highlighting the complex nature of these relationships . These analyses should be interpreted cautiously, particularly with small sample sizes, and researchers should consider multiple testing corrections when examining numerous correlations.

Threshold determination represents another critical aspect of mutant load analysis, as many mtDNA mutations exhibit threshold effects where clinical symptoms appear only when the proportion of mutant mtDNA exceeds a critical value . Researchers can employ receiver operating characteristic (ROC) curve analysis to identify potential threshold values that best discriminate between symptomatic and asymptomatic individuals or between different levels of biochemical defects . Additionally, comparative analysis across tissues is essential due to tissue-specific segregation of mitochondrial mutations, with mutant loads potentially varying significantly between blood, muscle, urinary epithelial cells, and other tissues . This variation necessitates careful consideration of tissue selection for diagnostic testing and interpretation of results in the clinical context. Together, these quantitative approaches enable robust analysis of MT-ND3 variant heteroplasmy and its relationship to disease manifestations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.