Recombinant Phodopus sungorus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Protein Characteristics

MT-ND4L is encoded by the mitochondrial genome and spans base pairs 10,469–10,765 in humans, producing an 11 kDa protein with 98 amino acids . Key structural features include:

  • Hydrophobic Transmembrane Domains: Integral to Complex I’s membrane-bound structure .

  • Overlap with MT-ND4: A unique 7-nucleotide overlap with MT-ND4 ensures efficient transcription and translation .

The protein is highly conserved across species, including Phodopus sungorus (Djungarian hamster), where its recombinant form is produced for research .

Functional Role in Mitochondrial Respiration

MT-ND4L is part of Complex I, which facilitates:

  • Electron Transfer: Transfers electrons from NADH to ubiquinone (coenzyme Q10) .

  • Proton Pumping: Generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis .

Key Mechanism:

  1. NADH Binding: Accepts electrons via flavin mononucleotide (FMN) .

  2. Electron Relay: Transfers electrons through iron-sulfur clusters to ubiquinone .

  3. Proton Translocation: Conformational changes pump protons into the intermembrane space .

Production and Characterization of Recombinant MT-ND4L

Recombinant MT-ND4L from Phodopus sungorus is produced via heterologous expression systems. Below is a comparative analysis of production parameters:

ParameterDetailsSources
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity>85% (SDS-PAGE)
StorageLyophilized: 12 months (-20°C/-80°C); Liquid: 6 months (-20°C/-80°C)
TaggingTag type determined during production (e.g., His-tag, GST-tag)
ApplicationsELISA kits, structural studies, disease modeling

Mitochondrial Disease Studies

MT-ND4L mutations are linked to Leber’s Hereditary Optic Neuropathy (LHON). A T10663C mutation (Val65Ala) disrupts Complex I function, impairing ATP production .

Chondrocyte Research

Studies in murine models show:

  • mt-Nd4l Downregulation: Correlates with mitochondrial respiratory chain (mtRC) dysfunction in cartilage .

  • ECM Changes: Increased expression of Thbs1 and Matn1 in response to mtRC damage .

Clinical and Diagnostic Relevance

ConditionRole of MT-ND4LSources
LHONT10663C mutation causes ATP deficiency, leading to optic nerve degeneration .
Metabolic DisordersVariants linked to obesity, diabetes, and hypertension .
Diagnostic ToolsRecombinant MT-ND4L used in ELISA kits for protein detection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)
Target Names
Target Protein Sequence
MMMAVLNISLAFIFSLLGTLMFRSHLMSTLLCLEGMMLTLFIITTITSLNSHSMVMYPIP IVILVFAACEAAVGLALLVKVSNTYGSDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This enzyme catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MT-ND4L in mitochondrial energy production?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a critical component of Complex I in the mitochondrial electron transport chain. This protein functions within the machinery that transfers electrons from NADH to ubiquinone, the first step in the electron transport process. This electron transfer creates an electrochemical gradient across the inner mitochondrial membrane that drives ATP production through oxidative phosphorylation .

The MT-ND4L protein is particularly important as one of the most hydrophobic subunits of Complex I and forms part of the core transmembrane region. It contributes to the characteristic L-shaped structure of Complex I, with its hydrophobic domain embedded in the inner mitochondrial membrane .

How is MT-ND4L encoded in the mitochondrial genome?

MT-ND4L is encoded by the mitochondrial genome rather than nuclear DNA. In humans, it spans from base pair 10,469 to 10,765 and produces an 11 kDa protein composed of 98 amino acids . While genomic coordinates in Phodopus sungorus may differ slightly, the gene likely maintains similar characteristics across mammalian species.

A notable feature observed in human MT-ND4L is its 7-nucleotide gene overlap with the MT-ND4 gene, where the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys and Stop) overlap with the first three codons of the MT-ND4 gene (5'-ATG CTA AAA-3' coding for Met-Leu-Lys) . This efficient genomic organization represents an unusual feature that might be conserved in Phodopus sungorus as well.

What expression systems are most effective for producing recombinant Phodopus sungorus MT-ND4L?

Expressing recombinant mitochondrial proteins like MT-ND4L presents unique challenges due to their hydrophobic nature and the differences between mitochondrial and nuclear genetic codes. For Phodopus sungorus MT-ND4L, researchers should consider these expression systems:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, rapid growth, economicalInclusion body formation common with hydrophobic proteinsUse fusion partners (MBP, SUMO), lower induction temperature (16-18°C), specialized E. coli strains (C41/C43)
Yeast (S. cerevisiae/P. pastoris)Eukaryotic processing capabilities, good for membrane proteinsLower yield than E. coliOptimization of growth media, use of strong inducible promoters
Cell-freeAvoids toxicity issues, direct incorporation into lipid environmentsExpensiveSupplementation with detergents or lipids

To enhance expression, codon optimization is essential to accommodate differences between mitochondrial and bacterial genetic codes. Additionally, using specialized vectors containing fusion tags (MBP, SUMO, or thioredoxin) can significantly enhance solubility of the hydrophobic MT-ND4L protein .

What purification strategies work best for recombinant Phodopus sungorus MT-ND4L?

Purifying hydrophobic membrane proteins like MT-ND4L presents significant challenges. Most effective strategies include:

  • Detergent-based extraction and purification:

    • Initial screening of detergents (DDM, LDAO, Triton X-100) to identify optimal solubilization conditions

    • Affinity chromatography using fusion tags (His-tag, FLAG-tag)

    • Size exclusion chromatography for final purification and detergent exchange

  • Inclusion body isolation and refolding:

    • Solubilization in strong denaturants (8M urea or 6M guanidine hydrochloride)

    • Refolding through dialysis in the presence of lipids or mild detergents

  • Nanodisc or liposome reconstitution:

    • Incorporation of purified protein into artificial membrane environments

    • Allows for functional studies in a native-like lipid bilayer

Table comparing purification method efficiencies:

MethodProtein StateAdvantagesExpected Yield
Detergent extractionSolubilizedMaintains native-like foldingLow to moderate (0.1-1 mg/L culture)
Inclusion body refoldingDenatured then refoldedHigh initial yieldVariable (0.5-2 mg/L culture)
Nanodisc/liposome reconstitutionMembrane-embeddedNative-like environmentVery low (μg quantities)

The hydrophobic nature of MT-ND4L makes it particularly challenging to maintain in a properly folded state during purification .

How can researchers verify the proper folding and functionality of recombinant Phodopus sungorus MT-ND4L?

Verifying proper folding and functionality of recombinant MT-ND4L is crucial for ensuring experimental validity. Recommended methods include:

  • Structural verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate conformational integrity

    • Thermostability assays to determine protein stability

  • Functional assessment:

    • Reconstitution with other Complex I subunits to evaluate assembly competence

    • NADH:ubiquinone oxidoreductase activity assays after reconstitution

    • Proton pumping assays in proteoliposomes

  • Interaction studies:

    • Cross-linking experiments to identify proper interactions with partner subunits

    • Blue native PAGE to assess complex formation

    • Co-immunoprecipitation with other Complex I components

These methods can confirm whether the recombinant protein maintains structural integrity and functional capabilities similar to the native protein .

What role does MT-ND4L play in ROS production in mitochondria, and how can this be studied?

Based on extensive studies of Complex I, MT-ND4L contributes to the core structure of the complex, which is known to be a major source of reactive oxygen species (ROS) in mitochondria. While MT-ND4L itself may not be directly involved in electron transfer to oxygen (which primarily occurs at the flavin site), structural integrity of the membrane domain is crucial for proper complex function .

Methods to study the role of recombinant Phodopus sungorus MT-ND4L in ROS production include:

  • Reconstitution studies: Incorporating purified recombinant MT-ND4L into partially assembled Complex I to assess its impact on ROS generation

  • Site-directed mutagenesis: Creating specific mutations in the recombinant MT-ND4L to identify residues that might influence the conformation of the complex and subsequently affect ROS production

  • In vitro assays: Using purified recombinant proteins in systems that measure superoxide production, such as:

    • Cytochrome c reduction assays

    • Amplex Red/horseradish peroxidase for H₂O₂ detection

    • Electron paramagnetic resonance (EPR) spectroscopy with spin traps

The mechanism of superoxide production in Complex I involves the transfer of one electron from fully reduced flavin to O₂. The resulting flavin radical is unstable, with the remaining electron likely redistributed to the iron-sulfur centers . Manipulating the recombinant MT-ND4L structure could help understand how alterations in complex assembly affect this process.

How might mutations in Phodopus sungorus MT-ND4L affect Complex I activity?

Based on studies in humans and other model organisms, mutations in MT-ND4L can significantly impact Complex I assembly and function. In Phodopus sungorus, potential effects might include:

  • Disrupted complex assembly: As MT-ND4L forms part of the membrane arm core, mutations could prevent proper complex formation.

  • Altered proton pumping: Changes in the transmembrane region might affect the efficiency of proton translocation across the inner membrane.

  • Increased ROS production: Structural changes to Complex I often lead to electron leakage and increased superoxide generation .

  • Energy deficiency: Reduced Complex I activity would diminish ATP production, potentially affecting high-energy demanding tissues.

  • Altered thermal regulation: Given Phodopus sungorus' adaptation to extreme temperatures and ability to enter torpor, MT-ND4L mutations might specifically impact temperature-dependent metabolic regulation.

Experimental approaches to assess these effects include:

  • Oxygen consumption measurements of isolated mitochondria

  • Membrane potential assessments using fluorescent probes

  • Blue native PAGE to examine complex assembly

  • In vitro enzyme activity assays with purified components

What role might MT-ND4L mutations play in mitochondrial disease models?

In humans, mutations in MT-ND4L have been associated with Leber hereditary optic neuropathy (LHON) . One specific mutation (T10663C or Val65Ala) changes a single amino acid in the protein, replacing valine with alanine at position 65. This suggests that even single amino acid changes in MT-ND4L can have significant pathological consequences .

For Phodopus sungorus, which serves as a valuable model organism for studying seasonal adaptation and metabolic regulation, MT-ND4L mutations could potentially:

  • Create models for studying mitochondrial dysfunction: Specific mutations could generate animal models of mitochondrial diseases that affect energy production.

  • Provide insights into metabolic adaptation: Studying naturally occurring variants might reveal how MT-ND4L contributes to the unique metabolic adaptations of this species.

  • Elucidate mechanisms of ROS-related pathology: Since MT-ND4L contributes to Complex I structure and ROS production is linked to oxidative stress, mutations could help establish connections between mitochondrial DNA damage and pathologies like atherosclerosis .

How does the MT-ND4L protein from Phodopus sungorus compare to that of humans?

While specific data on Phodopus sungorus MT-ND4L is limited, we can make informed comparisons based on evolutionary conservation of mitochondrial proteins:

Structural comparisons:

Functional aspects:

  • Core complex assembly: Both would serve essential roles in the assembly and stability of Complex I.

  • The contribution to proton pumping and electron transfer activities is likely conserved.

  • Species-specific adaptations may exist related to the hamster's ability to undergo daily torpor and adapt to extreme temperatures.

Potential unique features in Phodopus sungorus:

  • Adaptations related to cold tolerance and metabolic flexibility

  • Potential differences in ROS production characteristics that might relate to hibernation physiology

  • Altered interaction surfaces with nuclear-encoded subunits that might be species-specific

What experimental approaches can assess species-specific functions of MT-ND4L?

To investigate unique aspects of Phodopus sungorus MT-ND4L compared to other species:

  • Heterologous expression and complementation:

    • Express Phodopus sungorus MT-ND4L in systems lacking endogenous MT-ND4L

    • Compare functional complementation with MT-ND4L from other species

    • Assess temperature-dependent activity relevant to hibernating species

  • Chimeric protein analysis:

    • Create chimeric proteins containing domains from Phodopus sungorus and other species

    • Identify regions responsible for species-specific functional characteristics

    • Test assembly competence and activity under various conditions

  • Comparative biochemical analysis:

    • Side-by-side analysis of purified recombinant MT-ND4L from multiple species

    • Assess stability and activity across temperature ranges

    • Measure ROS production under conditions mimicking torpor/hibernation

  • Systems biology approach:

    • Integrate proteomic, transcriptomic, and metabolomic data

    • Compare mitochondrial function in tissues from Phodopus sungorus versus non-hibernating species

    • Correlate findings with MT-ND4L sequence and structural differences

How can recombinant Phodopus sungorus MT-ND4L be used to study mitochondrial superoxide production mechanisms?

Recombinant MT-ND4L provides a valuable tool for investigating the molecular mechanisms of mitochondrial superoxide production. Key experimental approaches include:

  • Reconstitution experiments:

    • Incorporate wild-type or mutant recombinant MT-ND4L into minimal Complex I systems

    • Manipulate NAD+/NADH ratios to assess superoxide production under different redox states

    • According to research, "the ratio and concentrations of NADH and NAD+ determine the rate of superoxide formation"

  • Structure-function analysis:

    • Create specific mutations at conserved residues to identify structural elements that influence ROS production

    • Test how these mutations affect the response to Complex I inhibitors

    • Measure superoxide production rates under various substrate conditions

  • Temperature-dependent studies:

    • Assess superoxide production at temperatures ranging from typical torpor (15-20°C) to normal body temperature (37°C)

    • Determine if Phodopus sungorus MT-ND4L exhibits unique temperature-dependent characteristics

    • Compare with MT-ND4L from non-hibernating species

The mechanism of superoxide production involves fully reduced flavin transferring an electron to O₂, with the remaining electron likely redistributed to iron-sulfur centers . By manipulating the MT-ND4L component, researchers can gain insights into how this process might be regulated in species with specialized metabolic adaptations.

What techniques are most effective for studying the assembly of Complex I incorporating recombinant MT-ND4L?

When investigating Complex I assembly with recombinant MT-ND4L, researchers should consider:

  • Stepwise reconstitution:

    • Begin with core subunits including recombinant MT-ND4L

    • Add peripheral subunits in defined order

    • Monitor assembly intermediates using native gel electrophoresis

  • Time-resolved analysis:

    • Pulse-chase experiments with labeled subunits

    • Capture assembly intermediates at different time points

    • Use cross-linking to freeze interactions at specific stages

  • Fluorescence-based approaches:

    • Label recombinant MT-ND4L with fluorescent tags

    • Monitor incorporation into larger complexes using FRET or fluorescence correlation spectroscopy

    • Track assembly in real-time in reconstituted systems

  • Cryo-EM analysis:

    • Visualize assembly intermediates at near-atomic resolution

    • Compare structures with wild-type versus mutant recombinant MT-ND4L

    • Identify critical interaction interfaces

The assembly process can be tracked using a combination of these techniques, creating a comprehensive picture of how MT-ND4L contributes to the formation of functional Complex I .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.