Recombinant Phosphate carrier protein, mitochondrial (F01G4.6)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant F01G4.6

The F01G4.6 gene encodes a 362-amino acid protein (UniProt ID: P40614) with a molecular weight of ~40 kDa . Recombinant F01G4.6 is produced in Escherichia coli (E. coli) with an N-terminal His tag for purification . Key features include:

PropertyDetails
SpeciesCaenorhabditis elegans
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length mature protein (residues 28–340)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with optional glycerol for stability

The recombinant protein’s amino acid sequence includes conserved motifs critical for phosphate transport, such as transmembrane helices and cytosolic-facing termini .

Production and Purification

Recombinant F01G4.6 is generated through the following workflow:

  1. Cloning: The F01G4.6 coding sequence (residues 28–340) is inserted into an E. coli expression vector .

  2. Expression: Induced under optimized conditions for soluble protein production.

  3. Purification: Affinity chromatography using the His tag, followed by buffer exchange and lyophilization .

Quality Control Metrics:

ParameterSpecification
Purity>90% by SDS-PAGE
StabilityStable at -80°C; avoid repeated freeze-thaw cycles
ApplicationsSDS-PAGE, structural studies, functional assays

Comparative Analysis with Orthologs

F01G4.6 shares evolutionary and functional similarities with mitochondrial phosphate carriers across species:

FeatureC. elegans (F01G4.6)Human (SLC25A3)Yeast (PIC2/MIR1)
SubstratesPhosphatePhosphate, copper Phosphate (MIR1), copper (PIC2)
Gene StructureSingle transcriptTwo isoforms (A and B) Two paralogs (PIC2 and MIR1)
Clinical RelevanceNot reportedMutations cause fatal cardiomyopathy N/A

Applications:

  • Functional studies: Reconstitution in liposomes to assay phosphate transport kinetics .

  • Structural biology: Crystallization trials to resolve transport mechanisms .

  • Disease modeling: Insights into human mitochondrial disorders linked to SLC25A3 mutations .

Limitations:

  • Species-specific differences: Functional data from C. elegans may not fully translate to human systems .

  • Lack of in vivo studies: Most research relies on in vitro assays; C. elegans knockout models are understudied .

Future Directions

  • Mechanistic studies: Resolve how F01G4.6 discriminates between substrates (e.g., phosphate vs. other anions) .

  • Therapeutic screening: Use recombinant F01G4.6 to identify inhibitors/activators for mitochondrial disorders .

  • Evolutionary analysis: Explore why copper transport is absent in C. elegans compared to mammals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order remarks. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us and we will prioritize developing the specified tag.
Synonyms
F01G4.6; Phosphate carrier protein, mitochondrial; PTP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-340
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
F01G4.6
Target Protein Sequence
AVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRT TIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAAS ASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIP YTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVS KLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPE MPASLKAKLAAQQ
Uniprot No.

Target Background

Function
Facilitates the transport of phosphate groups from the cytosol to the mitochondrial matrix.
Database Links

KEGG: cel:CELE_F01G4.6

STRING: 6239.F01G4.6b.2

UniGene: Cel.18209

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphate carrier protein, mitochondrial (F01G4.6) and what is its primary function?

Phosphate carrier protein, mitochondrial is encoded by the SLC25A3 gene in humans and F01G4.6 in Caenorhabditis elegans. It functions as a transmembrane protein located in the mitochondrial inner membrane that catalyzes the transport of phosphate ions from the cytosol into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. This transport is critical for oxidative phosphorylation, as it provides the inorganic phosphate required for ATP synthesis . The availability of inorganic phosphate for oxidative phosphorylation is primarily dependent on this protein's activity, and research indicates that depletion exceeding 85% is required to substantially affect oxidative phosphorylation .

How conserved is the Phosphate carrier protein across species?

The Phosphate carrier protein is highly conserved across metazoan species, reflecting its essential role in cellular metabolism. Orthologous genes include SLC25A3 in humans, Slc25a3 in mice, CG9090 in Drosophila melanogaster, and Sp-Slc25a3_2 in the sea urchin Strongylocentrotus purpuratus . This conservation suggests evolutionary pressure to maintain the protein's structure and function. Comparative studies between human SLC25A3 and C. elegans F01G4.6 reveal significant sequence homology, particularly in the transmembrane domains and substrate binding regions, supporting a conserved functional role across diverse organisms.

What is the structural organization of Phosphate carrier protein?

The Phosphate carrier protein (SLC25A3/F01G4.6) is a multi-pass transmembrane protein with a molecular weight of approximately 40.1 kDa, composed of 362 amino acids in humans. The protein contains six transmembrane segments with both the N-terminal and C-terminal regions protruding toward the cytosol . It features three related segments arranged in tandem, which are characteristic of the mitochondrial carrier family. There exist two significant isoforms of this protein in humans, PHC-A and PHC-B, which differ by 13 amino acids. Isoform A contains 42 amino acids while Isoform B contains 41 . These structural features are crucial for facilitating the controlled transport of phosphate ions across the mitochondrial membrane.

How do the different isoforms of Phosphate carrier protein differ in function and tissue distribution?

The two major isoforms of Phosphate carrier protein (PHC-A and PHC-B) demonstrate both functional and expression differences. In vitro studies have shown that these isoforms differ in their substrate affinities and transport rates . Regarding tissue distribution, Isoform A is expressed at high levels in heart, pancreatic, and skeletal muscle cells, while Isoform B is expressed more broadly across all tissues, albeit at lower levels .

These expression patterns have significant implications for pathology. In a documented case of mitochondrial phosphate carrier deficiency (MPCD), a homozygous mutation (c.215G>A) in the alternatively spliced exon 3A caused an amino acid replacement (G72E) specifically in Isoform A. This led to ATP synthase deficiency in muscle cells (which predominantly express Isoform A), but not in fibroblasts (which mainly express Isoform B), demonstrating the tissue-specific consequences of isoform-specific mutations .

What experimental approaches are most effective for studying the interaction partners of Phosphate carrier protein?

When investigating interaction partners of Phosphate carrier protein, researchers should implement multiple complementary approaches to ensure comprehensive and reliable results. Based on the established interactions data, F01G4.6 has been shown to interact with numerous proteins including PPP2R1A, ATAD3A, CANX, CLTC, MT-CO2, and several others .

The most effective experimental approaches include:

  • Co-immunoprecipitation (Co-IP) - This technique allows for the isolation of native protein complexes from cell lysates using specific antibodies. For F01G4.6/SLC25A3, this approach has helped identify interactions with multiple proteins.

  • Proximity-dependent biotin identification (BioID) - This method identifies proximal and transient interactions in living cells by fusing the protein of interest with a biotin ligase.

  • Yeast two-hybrid screening - While this technique has limitations for membrane proteins, modified versions can be used to identify potential interactors.

  • Mass spectrometry-based proteomics - This approach can identify components of protein complexes containing F01G4.6/SLC25A3 through affinity purification followed by mass spectrometry analysis.

Validation of these interactions should include reverse Co-IP experiments, localization studies using fluorescent microscopy, and functional assays to determine the biological significance of identified interactions.

How can researchers effectively design experiments to investigate the role of F01G4.6 in mitochondrial function?

Designing experiments to investigate F01G4.6's role in mitochondrial function requires careful consideration of variables, appropriate controls, and selection of relevant measurement techniques. Following the five key steps of experimental design is essential :

  • Define variables - The independent variable might be F01G4.6 expression levels (wild-type, knockdown, knockout, or overexpression), while dependent variables could include oxygen consumption rate, ATP production, phosphate transport rate, or mitochondrial membrane potential .

  • Formulate specific hypotheses - For example, "Knockdown of F01G4.6 will decrease phosphate transport into mitochondria and subsequently reduce ATP production."

  • Design treatments - Create experimental groups with different F01G4.6 expression levels using RNA interference, CRISPR-Cas9, or overexpression constructs .

  • Assign subjects to groups - For cell culture experiments, ensure proper randomization of samples; for C. elegans studies, use age-synchronized populations with appropriate genetic backgrounds .

  • Measure dependent variables - Use techniques such as Seahorse XF analyzers for oxygen consumption, luciferase-based assays for ATP quantification, or radiolabeled phosphate uptake assays .

What are the best methods for producing recombinant Phosphate carrier protein for functional studies?

Production of high-quality recombinant Phosphate carrier protein presents challenges due to its hydrophobic nature and multiple transmembrane domains. The following methodological approaches have proven most successful:

  • Expression system selection - E. coli-based systems often result in inclusion bodies, requiring refolding. Eukaryotic systems like insect cells (Sf9, High Five) or yeast (P. pastoris) generally provide better folding of membrane proteins.

  • Vector design considerations - Include purification tags (His6, FLAG, or Strep-tag II) at either terminus, ensuring they don't interfere with protein folding. For challenging constructs, fusion partners like maltose-binding protein (MBP) or green fluorescent protein (GFP) can improve solubility and expression.

  • Membrane protein extraction - Use gentle detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or lauryl maltose neopentyl glycol (LMNG) that maintain protein structure and function.

  • Purification strategy - Implement a two-step purification approach combining affinity chromatography with size exclusion chromatography to obtain homogeneous protein preparations.

  • Functional validation - Confirm activity through liposome reconstitution assays measuring phosphate transport using radioactive tracers (32P) or fluorescent probes.

This methodological workflow has been successfully applied to produce functional recombinant Phosphate carrier protein suitable for structural and functional analyses .

What techniques are most appropriate for evaluating phosphate transport activity in experimental systems?

Measuring phosphate transport activity of F01G4.6/SLC25A3 requires techniques that can detect phosphate movement across membranes with high sensitivity. The following methodologies are most appropriate:

  • Radioisotope-based transport assays - Using 32P-labeled inorganic phosphate to track transport in:

    • Isolated mitochondria

    • Proteoliposomes containing reconstituted purified protein

    • Permeabilized cells

  • Fluorescent probe-based methods - Utilizing phosphate-sensitive fluorescent probes:

    • BCECF for pH changes associated with phosphate/H+ symport

    • Phosphate-binding protein labeled with environment-sensitive fluorophores

  • Electrophysiological techniques - For direct measurement of transport-associated currents:

    • Patch-clamp of mitoplasts (mitochondria with outer membrane removed)

    • Planar lipid bilayer systems with reconstituted protein

  • Indirect functional assays - Measuring phosphate transport consequences:

    • Oxygen consumption rate (OCR) using Seahorse analyzers

    • ATP production capacity

    • Mitochondrial membrane potential using voltage-sensitive dyes

Each technique offers distinct advantages, and researchers should select based on their specific experimental questions and available equipment. Combining multiple approaches provides more robust evidence of transport activity.

How can researchers effectively analyze the impact of mutations in F01G4.6 on protein function?

Analyzing the impact of mutations in F01G4.6 requires a multi-faceted approach combining molecular, cellular, and physiological techniques:

  • Computational analysis and prediction:

    • Sequence conservation analysis across species

    • Structural modeling to predict how mutations affect protein folding and substrate binding

    • Molecular dynamics simulations to assess conformational changes

  • In vitro functional characterization:

    • Site-directed mutagenesis to generate specific mutations

    • Expression in heterologous systems (bacteria, yeast, insect cells)

    • Purification and reconstitution into liposomes for transport assays

    • Thermal stability assays to assess effects on protein folding

  • Cellular models:

    • CRISPR-Cas9 knock-in of specific mutations in cell lines

    • Rescue experiments in knockout backgrounds

    • Assessment of mitochondrial function (membrane potential, respiration, ATP production)

    • Localization studies to confirm proper targeting to mitochondria

  • Organismal models:

    • Generation of C. elegans strains carrying specific F01G4.6 mutations

    • Phenotypic assessment including lifespan, stress resistance, and metabolic parameters

    • Tissue-specific analyses focusing on high-energy demanding tissues

This comprehensive approach allows researchers to connect molecular changes to physiological consequences, providing valuable insights into structure-function relationships of the Phosphate carrier protein.

What are common challenges in studying F01G4.6 and how can they be addressed?

Researchers studying F01G4.6/Phosphate carrier protein frequently encounter several technical challenges:

  • Protein solubility and stability issues:

    • Challenge: As a multi-pass membrane protein, F01G4.6 is often difficult to extract and maintain in a stable, functional form.

    • Solution: Optimize detergent selection (try DDM, LMNG, or digitonin); include stabilizing additives such as glycerol (10-15%); maintain samples at 4°C; consider adding lipids during purification to maintain the native environment.

  • Low expression levels:

    • Challenge: Obtaining sufficient quantities of recombinant protein for functional and structural studies.

    • Solution: Test multiple expression systems (bacterial, yeast, insect, mammalian); optimize codon usage for the expression host; use stronger promoters; consider fusion tags that enhance expression (MBP, SUMO).

  • Functional assay sensitivity:

    • Challenge: Detecting the relatively slow phosphate transport activity against background.

    • Solution: Increase signal-to-noise ratio by using highly purified mitochondria or proteoliposomes; optimize buffer compositions to reduce non-specific binding; extend measurement times; use appropriate controls (ionophores, known inhibitors).

  • Phenotypic complexity in model organisms:

    • Challenge: F01G4.6 mutations in C. elegans often result in pleiotropic effects making specific function difficult to isolate.

    • Solution: Use tissue-specific or conditional knockdown/knockout; perform careful time-course studies; combine with other genetic tools to dissect specific pathways.

  • Distinguishing direct from indirect effects:

    • Challenge: Determining whether observed phenotypes are directly caused by F01G4.6 dysfunction.

    • Solution: Perform rescue experiments with wild-type and mutant versions; use acute inhibition rather than chronic genetic manipulation; measure proximal outputs (phosphate transport) and distal consequences (ATP levels, growth) in parallel.

How should researchers interpret contradictory findings regarding F01G4.6 function across different experimental systems?

When faced with contradictory findings regarding F01G4.6 function across different experimental systems, researchers should follow this systematic approach:

  • Evaluate methodological differences:

    • Different expression systems may produce proteins with varying post-translational modifications

    • Isolation methods might affect protein stability and function

    • Assay conditions (pH, temperature, ionic strength) can significantly influence transport activity

  • Consider biological context:

    • Species-specific differences in regulatory mechanisms

    • Cell/tissue-specific isoform expression patterns

    • Presence of different interaction partners across systems

    • Compensatory mechanisms in chronic vs. acute loss of function

  • Analyze data quality metrics:

    • Statistical power and significance

    • Reproducibility across independent experiments

    • Controls for system-specific artifacts

    • Sensitivity and specificity of detection methods

  • Develop integrative models:

    • Create testable hypotheses that might explain observed discrepancies

    • Design experiments specifically aimed at resolving contradictions

    • Consider that contradictions may reveal novel regulatory mechanisms

  • Implementation strategies:

    • Use multiple complementary techniques on the same biological material

    • Carefully control experimental variables across systems

    • Collaborate with specialists in different model systems

    • Develop standardized protocols to facilitate cross-laboratory comparisons

This structured approach helps researchers distinguish genuine biological complexity from technical artifacts when interpreting seemingly contradictory results.

What statistical approaches are most appropriate for analyzing data from phosphate transport experiments?

The analysis of phosphate transport data requires appropriate statistical methods to account for the specific characteristics of transport kinetics and experimental variability:

  • Kinetic parameter estimation:

    • Non-linear regression analysis for Michaelis-Menten kinetics

    • Determination of transport parameters (Km, Vmax) with confidence intervals

    • Comparison of models (e.g., single site vs. multiple binding sites) using Akaike Information Criterion or F-test

  • Time-course transport data analysis:

    • Area under the curve (AUC) calculations for cumulative transport

    • First-order rate constant determination for initial velocity measurements

    • Repeated measures ANOVA for time-dependent differences between conditions

  • Comparison between experimental conditions:

    • Paired t-tests for direct comparisons between control and treatment in the same preparation

    • One-way ANOVA with appropriate post-hoc tests (Tukey, Dunnett) for multiple condition comparisons

    • Two-way ANOVA for examining interactions between treatment factors

  • Data transformation considerations:

    • Log transformation for data with multiplicative effects

    • Assessment of normality and homoscedasticity assumptions

    • Non-parametric alternatives when assumptions are violated

  • Dealing with experimental variability:

    • Mixed-effects models to account for batch effects

    • Normalization strategies using internal standards

    • Power analysis to determine appropriate sample sizes

The following table summarizes statistical approach recommendations based on experimental design:

Experimental DesignPrimary AnalysisAlternative ApproachRequired Sample Size
Two conditions, single timepointPaired t-testWilcoxon signed-rankn ≥ 6 pairs
Multiple conditions, single timepointOne-way ANOVAKruskal-Wallisn ≥ 5 per group
Multiple conditions, multiple timepointsTwo-way repeated measures ANOVAMixed-effects modeln ≥ 4 per group
Dose-response experimentsNon-linear regressionSpline interpolation≥ 7 concentrations
Correlation of transport with physiological parametersPearson/Spearman correlationLinear regressionn ≥ 10 samples

What are emerging questions about Phosphate carrier protein that remain to be addressed?

Despite significant advances in understanding Phosphate carrier protein, several crucial questions remain unanswered:

  • Structural dynamics during transport:

    • What conformational changes occur during the transport cycle?

    • How do these changes couple to the proton gradient or hydroxyl exchange?

    • Can we develop real-time monitoring of structural changes during transport?

  • Regulatory mechanisms:

    • What post-translational modifications regulate F01G4.6/SLC25A3 activity?

    • How is expression regulated under different metabolic states?

    • Do tissue-specific regulatory factors explain differential isoform expression?

  • Integration with mitochondrial biology:

    • How does Phosphate carrier protein coordinate with other transporters and the electron transport chain?

    • What is its role in mitochondrial permeability transition pore regulation ?

    • How does it contribute to mitochondrial adaptation to metabolic challenges?

  • Disease relevance beyond MPCD:

    • Are there subclinical phenotypes associated with partial loss of function?

    • Does the protein play a role in common metabolic disorders?

    • Could it be targeted therapeutically in conditions of mitochondrial dysfunction?

  • Evolutionary adaptations:

    • How has the protein evolved across different taxa with varying metabolic demands?

    • Are there species-specific adaptations that provide insights into function?

    • What can we learn from organisms with unique mitochondrial phosphate transport systems?

These questions represent fertile ground for future research and will require innovative approaches spanning structural biology, systems biology, and translational research.

What novel methodological approaches might advance our understanding of F01G4.6 function?

Advancing our understanding of F01G4.6 function will require innovative methodological approaches that overcome current limitations:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize protein distribution within mitochondrial subcompartments

    • Single-molecule tracking to monitor protein dynamics in live cells

    • Correlative light and electron microscopy (CLEM) to connect functional data with ultrastructural context

  • Structural biology innovations:

    • Cryo-electron microscopy to determine high-resolution structures in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during transport

    • In-cell NMR to examine protein structure and dynamics in native environments

  • Genetic and genomic approaches:

    • CRISPR-based screens to identify genetic modifiers of F01G4.6 function

    • Tissue-specific and temporal control of gene expression using optogenetic or chemogenetic tools

    • Single-cell transcriptomics to understand cell-to-cell variability in response to F01G4.6 perturbation

  • Biochemical and biophysical methods:

    • Nanoscale electrochemical detection of phosphate transport in real-time

    • Reconstitution in artificial mitochondrial membrane systems with controlled composition

    • Development of specific, reversible inhibitors as chemical probes

  • Computational approaches:

    • Molecular dynamics simulations at extended timescales to capture complete transport cycles

    • Machine learning analysis of sequence-structure-function relationships

    • Systems biology modeling of mitochondrial phosphate homeostasis

Integration of these diverse approaches through collaborative research will provide a more comprehensive understanding of F01G4.6 function and its role in cellular physiology.

How might research on F01G4.6 contribute to understanding broader aspects of mitochondrial biology?

Research on F01G4.6/Phosphate carrier protein has significant potential to illuminate broader aspects of mitochondrial biology:

  • Mitochondrial bioenergetics regulation:

    • Understanding how phosphate availability functions as a rate-limiting factor in oxidative phosphorylation

    • Elucidating the coordination between substrate transport and ATP synthesis

    • Revealing adaptations to varying energy demands across tissues and physiological states

  • Mitochondrial membrane organization:

    • Investigating how carrier proteins like F01G4.6 are organized within the inner membrane

    • Exploring potential roles in contact sites between inner and outer membranes

    • Understanding how carrier protein distribution affects local bioenergetic efficiency

  • Mitochondrial evolution:

    • Comparing transport mechanisms across evolutionary diverse organisms

    • Identifying conserved features essential for mitochondrial function

    • Uncovering adaptations that reflect different metabolic strategies

  • Disease mechanisms:

    • Beyond MPCD, investigating roles in common metabolic disorders

    • Understanding tissue-specific vulnerability to phosphate transport defects

    • Developing potential therapeutic approaches targeting mitochondrial phosphate homeostasis

  • Integrative cell biology:

    • Examining crosstalk between mitochondrial phosphate transport and cytosolic phosphate-dependent processes

    • Understanding connections to calcium homeostasis and cell signaling

    • Exploring roles in cellular adaptations to stress conditions

By positioning F01G4.6 research within these broader contexts, investigators can contribute not only to understanding this specific protein but also to fundamental questions in cell biology and physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.