Recombinant Phosphate regulon sensor protein phoR (phoR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phosphate Regulon Sensor Protein PhoR

Recombinant Phosphate Regulon Sensor Protein PhoR, commonly referred to as PhoR, is a crucial component in the phosphate (Pho) regulon of Escherichia coli (E. coli) and other bacteria . The Pho regulon is a regulatory network that manages phosphate homeostasis within the cell, responding to changes in environmental phosphate levels . PhoR is a histidine kinase sensor protein located in the inner membrane, playing a pivotal role in signal transduction related to phosphate availability .

Structure and Function of PhoR

PhoR is a member of the two-component regulatory system PhoR/PhoB . As an integral membrane protein, PhoR senses periplasmic orthophosphate (Pi) concentration variations through interactions with a phosphate transport system . Its structure includes several key domains:

  • Dimerization and Histidine Phosphorylation (DHp) domain: Extends from amino acid residue 193 to residue 267 .

  • Catalytic and ATP-binding (CA) domain: Located between amino acid residues 267 and 431 .

  • PAS domain: Involved in the interaction with the PhoU protein .

PhoR functions primarily as a histidine kinase . Under phosphate-limiting conditions, PhoR autophosphorylates at a histidine residue and subsequently transfers this phosphoryl group to an aspartate residue on its partner response regulator, PhoB . This phosphorylation of PhoB activates it, allowing it to bind to specific DNA sequences and either activate or repress the transcription of genes involved in phosphate acquisition and metabolism .

PhoR's Role in Phosphate Regulation

The Pho regulon, controlled by the PhoR/PhoB system, is essential for bacterial adaptation, survival, and pathogenicity . When phosphate concentrations are below 4 μM, PhoR activates PhoB via phosphorylation . Activated PhoB then modulates the expression of numerous genes, including those encoding:

  • Alkaline phosphatase (PhoA): Hydrolyzes phosphate esters to release inorganic phosphate .

  • Phosphate-specific transport (Pst) system: An ABC-type transporter that facilitates the uptake of phosphate .

  • PhoU protein: Involved in the formation of a signaling complex at the cytoplasmic membrane that responds to environmental Pi levels .

Interaction with Other Proteins

  • PhoB: The response regulator that receives the phosphate signal from PhoR and regulates gene expression .

  • PhoU: Participates in a signaling complex at the cytoplasmic membrane, responding to environmental phosphate levels and interacting with PhoR and the Pst system .

  • Pst System: The phosphate-specific transport system interacts with PhoR to sense periplasmic phosphate concentrations .

  • PitA and Pho89: Proteins that import Pi, inhibiting PhoB/PhoR signal transduction when Pi is abundant .

  • CreC: Can phosphorylate PhoB in the absence of PhoR phosphatase activity, contributing to alkaline phosphatase production under high-phosphate conditions .

Research Findings and Experimental Evidence

Genetic and biochemical studies have provided significant insights into the function and regulation of PhoR.

  • Phosphatase Activity of PhoR: Studies have shown that PhoR can function as a phospho-PhoB phosphatase, dephosphorylating PhoB under high-phosphate conditions to inhibit the Pho regulon .

  • PhoU Interactions: Research indicates that PhoU interacts with the PAS domain of PhoR, which is crucial for the formation of a functional signaling complex .

  • Inhibition by Phosphate Importers: Experiments have demonstrated that proteins like PitA and Pho89, which import inorganic phosphate, can repress PhoB/PhoR activity when cytoplasmic phosphate levels are sufficient .

Table 1: Alkaline Phosphatase Activity in phoR Mutants

Strain (reference)DeletionAlkaline phosphatase activity (arbitrary units ± SD)
BW25113 (3)None (wild type)4.0 ± 1.5
BW25141 (3)Δ phoBR1.0 ± 0.6
KH500Δ phoR, entire gene56 ± 4
KH550ΔPAS, DHp, CA83 ± 5
KH570ΔDHp, CA82 ± 9
KH580ΔCA21 ± 1

These data illustrate how different deletions within PhoR affect alkaline phosphatase activity, providing insights into the functional roles of specific PhoR domains .

Role in Bacterial Virulence

The Pho regulon, with PhoR as a key component, plays a significant role in the virulence of several bacteria . It is involved in:

  • Regulation of virulence factors: The Pho regulon modulates the expression of genes encoding virulence factors, contributing to the pathogenesis of bacterial infections .

  • Stress response: It is part of a complex network that helps bacteria respond to stress conditions, including nutrient starvation and environmental changes .

Methods for Monitoring PhoB Phosphorylation

Techniques have been developed to monitor the phosphorylation state of PhoB, offering valuable tools for studying PhoR activity and the Pho regulon:

  • Phos-tag™ gel electrophoresis: Separates phosphorylated and unphosphorylated forms of response regulator proteins, enabling the detection of specific phosphorylated proteins in complex mixtures .

  • Monitoring with phosphoramidate: Small molecule phosphoryl group donors like phosphoramidate can be used in vitro to characterize the phosphorylation of PhoB .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have special requirements. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its incorporation.
Synonyms
phoR; Phosphate regulon sensor protein PhoR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
phoR
Target Protein Sequence
MLERLSWKRLALELFLACIPALILGAFVGHLPWFLLAAVTGLLIWHFWNLMRLSWWLWVD RSMTPPPGRGSWEPLLYGLHQMQMRNKKRRRELGSLIKRFRSGAESLPDAVVLTTEEGAI FWCNGLAQQILNLRWPDDSGQNILNLLRYPEFANYLKQRDFSKPLNLVLNNARHLEIRVM PYTDKQWLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMQEQVLEGATRE KALHTMREQTQRMEGLVKQLLTLSRIEAAPALAMNDRIDVPMMLRVVEREAQTLSQEKQT LIFTVDEQLKVLGNEEQLRSAISNLVYNAVNHTPPGTEIRVSWQRTPQGALFSVEDNGPG IAPEHIPLLTERFYRGDKARSRQTGGSGLGLAIVKHAVNHHDSRLEIDSTVGKGTRFSFL LPERLIARNDA
Uniprot No.

Target Background

Function
Recombinant Phosphate regulon sensor protein PhoR is a member of the two-component PhoR/PhoB regulatory system, controlling the expression of phosphate regulon genes. PhoR functions as a membrane-associated histidine kinase, phosphorylating PhoB in response to environmental phosphate levels.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the PHO regulon and what role does PhoR play in bacterial phosphate sensing?

The PHO regulon is a large regulatory network in bacteria responsible for controlling phosphate (Pi) homeostasis. PhoR functions as a membrane-bound sensor histidine kinase within the two-component regulatory system PhoR/PhoB that governs the PHO regulon .

PhoR plays a critical role by:

  • Autophosphorylating at His215 under low phosphate conditions

  • Transferring its phosphate group to the response regulator PhoB

  • Functioning as a phosphatase on phospho-PhoB when Pi is abundant

Unlike many other sensor histidine kinases, PhoR lacks a significant periplasmic sensory domain and instead contains an extended cytoplasmic domain that is proposed to sense internal signals that regulate its kinase function . The PhoR/PhoB system activates in response to Pi limitation (<4 μM), triggering expression of genes involved in phosphate acquisition and metabolism .

How does the PhoR-PhoB two-component signaling system function at the molecular level?

The PhoR-PhoB two-component signaling system operates through a phosphorylation cascade that translates environmental phosphate levels into gene expression changes:

  • Low Pi detection: When environmental Pi is limited, PhoR undergoes autophosphorylation at His215

  • Phosphotransfer: Phosphorylated PhoR transfers the phosphate group to Asp53 in the receiver domain of PhoB

  • Conformational change: Phosphorylation causes a dramatic conformational change in PhoB that releases its DNA binding domain

  • Transcriptional activation: Phosphorylated PhoB (PhoB-P) binds to specific sequences called PHO boxes in the promoter regions or within open reading frames (ORFs) of target genes

  • Gene expression: This binding activates transcription of the PHO regulon genes, including the phosphate-specific transport system (pstSCAB-phoU) and other phosphate acquisition genes

  • Deactivation: When Pi becomes abundant, PhoR functions as a phosphatase, dephosphorylating PhoB-P and halting PHO regulon expression

This molecular mechanism enables bacteria to respond dynamically to changing phosphate availability in their environment, allowing efficient adaptation to nutrient-limited conditions.

What is the relationship between PhoR, PhoB, and PhoU in regulating phosphate homeostasis?

The intricate relationship between PhoR, PhoB, and PhoU creates a sophisticated regulatory network for phosphate homeostasis:

PhoR-PhoB relationship:

  • PhoR functions as both a kinase and phosphatase for PhoB depending on Pi levels

  • The phosphorylated/dephosphorylated PhoB ratio is a key parameter in controlling the PHO regulon

PhoU's regulatory role:

  • PhoU acts as a negative modulator of PHO regulon expression

  • PhoU expression itself is dependent on PhoP activation, creating a feedback control mechanism (self-regulation)

  • In high Pi conditions, PhoU is essential for repression of the PHO regulon by binding to PhoR, PhoB, or the PhoR-PhoB complex as a chaperone

  • PhoU promotes dephosphorylation of phospho-PhoB when Pi is abundant

  • When phoU is mutated or deleted, PhoR behaves as a constitutive PhoB kinase, leading to high expression of PHO regulon genes

This three-component system creates a balanced regulatory circuit: PhoB-P strongly activates expression of PHO regulon genes (including phoU), while the resulting PhoU protein then negatively modulates this activation, preventing overexpression . This feedforward/feedback loop ensures appropriate phosphate uptake while preventing toxic accumulation of Pi within the cell .

What is known about the structure and localization of PhoR in bacterial cells?

PhoR is a membrane-bound sensor histidine kinase with distinct structural domains that contribute to its function in phosphate sensing:

Structural features:

  • Unlike many histidine kinases, PhoR lacks a significant periplasmic sensory domain

  • PhoR contains an extended cytoplasmic domain proposed to sense internal signals

  • The protein includes a Per-Arnt-Sim (PAS) domain that likely senses cytoplasmic signals, though the exact nature of these signals remains unknown

  • Contains a catalytic domain responsible for autophosphorylation at His215

  • Functions as a histidine kinase (EC 2.7.13.3)

Cellular localization:

  • PhoR is membrane-associated, anchored to the inner bacterial membrane

  • Its extended cytoplasmic domain allows interaction with both the membrane environment and cytoplasmic components

  • This positioning enables PhoR to integrate signals from both the periplasmic space and cytoplasm

Functional implications:

  • The membrane localization places PhoR in proximity to the Pst system components, allowing formation of regulatory complexes

  • The cytoplasmic domain orientation facilitates interaction with the soluble response regulator PhoB

  • This arrangement may enable PhoR to monitor internal Pi levels rather than directly sensing environmental Pi

While significant structural details have been established, the precise mechanism by which PhoR senses phosphate limitation remains an active area of research.

What are the key challenges and considerations when expressing recombinant PhoR protein?

Expressing recombinant PhoR presents several significant challenges due to its nature as a membrane-associated histidine kinase:

Expression challenges:

  • Membrane protein solubility: As a membrane-associated protein, PhoR may form inclusion bodies when overexpressed in heterologous systems

  • Translation initiation efficiency: The accessibility of translation initiation sites significantly impacts expression success, with approximately 50% of recombinant proteins failing expression in various host cells

  • mRNA secondary structure: Strong secondary structures near the translation initiation site can impede ribosome binding and reduce expression

  • Cellular toxicity: Overexpression of functional PhoR may disrupt native phosphate homeostasis in the expression host, potentially causing growth defects or selection against high-expressing clones

  • Post-translational modifications: Ensuring proper phosphorylation capacity in the recombinant protein

Optimization strategies:

  • Codon optimization: Modifying the first nine codons with synonymous substitutions can significantly improve expression levels without altering the protein sequence

  • TIsigner approach: Using simulated annealing to design sequences with improved translation initiation site accessibility

  • Host selection: Choosing expression systems with phosphate regulation pathways different from the source organism to prevent interference

  • Fusion tags: Adding solubility-enhancing tags and appropriate linkers with cleavage sites

  • Expression conditions: Optimizing temperature, induction timing, and media composition to balance protein production with cell growth

Research has shown that higher accessibility of translation initiation sites leads to higher protein production, though this comes at the cost of slower cell growth, supporting the concept of "protein cost" where cell growth is constrained by protein overexpression .

How can researchers design experiments to study PhoR-PhoB phosphorylation dynamics?

Designing robust experiments to study PhoR-PhoB phosphorylation dynamics requires careful consideration of both experimental design and analytical methods:

Experimental approaches:

  • In vitro phosphorylation assays:

    • Purify recombinant PhoR and PhoB proteins

    • Incubate with radioactive ATP (γ-32P-ATP) to track phosphorylation

    • Monitor phosphotransfer rates under varying conditions (Pi concentration, pH, temperature)

    • Use phosphomimetic mutations (e.g., His→Asp) to study constitutively active/inactive forms

  • In vivo reporter systems:

    • Construct PHO box-controlled reporter gene fusions (e.g., lacZ, gfp)

    • Monitor expression under varying phosphate conditions

    • Design time-course experiments to capture activation/deactivation kinetics

    • Implement inducible expression systems to control PhoR/PhoB/PhoU levels

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays to detect PhoR-PhoB and PhoR-PhoU interactions

    • Co-immunoprecipitation to isolate interacting complexes

    • Förster resonance energy transfer (FRET) to monitor interactions in real-time

Analytical considerations:

  • Control of phosphate conditions: Use defined media with precise Pi concentrations (ranging from <4μM to >4μM)

  • Time-resolved measurements: Implement time-course sampling to capture dynamics

  • Genetic backgrounds: Compare wild-type, ΔphoR, ΔphoB, and ΔphoU strains

  • Quantitative measurements: Use RT-PCR to measure expression of PHO regulon genes like glpQ1, pstS, and phoR

These approaches can be combined in comprehensive research designs that examine both in vitro biochemical properties and in vivo physiological relevance of PhoR-PhoB phosphorylation dynamics.

What molecular mechanisms underlie PhoU modulation of PhoR activity?

The molecular mechanisms by which PhoU modulates PhoR activity involve sophisticated protein-protein interactions and conformational changes:

PhoU's molecular role:

  • Chaperone function: PhoU acts as a chaperone that binds to PhoR, PhoB, or the PhoR-PhoB complex to promote dephosphorylation of phospho-PhoB under high Pi conditions

  • Repression complex formation: PhoU participates in forming a repression complex with PhoR and possibly PstB (from the Pst system) when Pi is abundant (>4μM)

  • Negative modulation: PhoU negatively modulates PHO regulon expression as confirmed by RT-PCR studies of genes like glpQ1, pstS, and phoR

  • Prevention of toxic Pi accumulation: PhoU controls the Pst system to prevent uncontrolled phosphate uptake that could be toxic to the cell

Regulatory circuit dynamics:

  • Autoregulatory feedback: PhoU expression is strictly dependent on PhoP activation, creating a feedback control mechanism

  • Interaction interfaces: While complete structural details remain to be elucidated, PhoU likely interacts with specific domains of PhoR to modulate its kinase/phosphatase balance

  • Signal integration: PhoU may serve as an integrator of signals from the Pst transport system to PhoR, linking transport activity to gene regulation

The exact molecular interactions and structural changes that occur during PhoU-mediated modulation of PhoR remain incompletely understood and represent an important area for future research using techniques like cryo-electron microscopy, X-ray crystallography, and advanced molecular dynamics simulations.

How does the PhoR-PhoB system interact with other bacterial regulatory networks?

The PhoR-PhoB system participates in complex cross-talk with other bacterial regulatory networks, creating an integrated response to environmental conditions:

Integration with virulence regulation:

  • In Edwardsiella tarda, the PhoB-PhoR system interacts with the ferric uptake regulator (Fur) to regulate the expression of type III and VI secretion systems through an E. tarda secretion regulator, EsrC

  • This demonstrates how phosphate and iron sensing pathways converge to control virulence gene expression

Regulatory network interactions:

  • Nutrient sensing integration: PhoR-PhoB system coordinates with other nutrient-sensing systems to balance metabolic responses

  • Stress response coordination: Cross-talk exists between phosphate limitation responses and other stress response pathways

  • Virulence regulation: As seen in E. tarda, phosphate limitation can be sensed as an environmental cue to trigger virulence mechanisms

Experimental approaches to study network interactions:

  • Global transcriptomic analysis: RNA-seq to identify genes co-regulated by multiple systems

  • Chromatin immunoprecipitation sequencing (ChIP-seq): Identify binding sites for PhoB and other transcription factors to detect overlapping regulons

  • Synthetic biology approaches: Rewiring regulatory components to test interaction models

  • Epistasis analysis: Genetic studies using combinations of regulatory gene mutations

Understanding these regulatory intersections is crucial for developing a comprehensive model of bacterial adaptation to host environments and may reveal new targets for antimicrobial development.

What experimental designs are optimal for studying the effects of phosphate limitation on PhoR-dependent gene expression?

Designing rigorous experiments to study phosphate limitation effects on PhoR-dependent gene expression requires careful consideration of multiple factors:

Experimental design considerations:

  • Research design selection:

    • Correlational designs: Measure natural variations in gene expression and phosphate levels

    • Experimental designs: Actively manipulate phosphate levels and observe resulting changes in gene expression

    • Longitudinal designs: Track changes over time to capture adaptation dynamics

  • Phosphate limitation protocols:

    • Create defined media with precise Pi concentrations (<4μM for limitation, >4μM for sufficiency)

    • Implement controlled Pi depletion through timed growth and media replacement

    • Consider gradual versus sudden Pi limitation to distinguish acute and adaptive responses

  • Gene expression analysis methods:

    • Promoter-reporter fusions: Construct fusions between PHO box-containing promoters and reporter genes (gfp, lacZ)

    • Quantitative RT-PCR: Measure expression of PHO regulon genes (glpQ1, pstS, phoR)

    • RNA-Seq: Genome-wide transcriptome analysis to identify all PhoR-regulated genes

    • Time-resolved sampling: Capture expression dynamics during transition between Pi-replete and Pi-limited conditions

  • Genetic backgrounds to include:

    • Wild-type strains

    • ΔphoR and ΔphoB deletion mutants as negative controls

    • ΔphoU mutants to study derepression effects

    • Complemented strains to confirm phenotype specificity

    • PhoR/PhoB phosphorylation site mutants (e.g., His215Ala in PhoR)

Data analysis and interpretation:

  • Statistical approaches: Use appropriate statistical methods to distinguish causal relationships from correlations

  • Normalization strategies: Account for growth rate differences under different Pi conditions

  • Integration of multiple data types: Combine transcriptomic, proteomic, and metabolomic data

This comprehensive experimental approach allows researchers to dissect the complex regulatory mechanisms governing PhoR-dependent gene expression in response to phosphate limitation.

What purification strategies are most effective for obtaining active recombinant PhoR protein?

Purifying active recombinant PhoR presents significant challenges due to its membrane association and complex regulatory functions. The following methodological approach addresses these challenges:

Expression system optimization:

  • Vector selection: Use vectors with tunable expression control to prevent toxic overexpression

  • Fusion tag strategies:

    • N-terminal His6-tag for IMAC purification

    • Solubility-enhancing tags (MBP, SUMO, or TrxA) with protease cleavage sites

    • Consider dual tagging approaches (e.g., His-MBP) for enhanced purification

  • Host strain considerations:

    • Use E. coli strains with mutations in native phoR to prevent interference

    • Consider expression in phoU deletion strains with appropriate growth optimization

    • Evaluate specialized strains designed for membrane protein expression

Purification protocol development:

  • Membrane fraction isolation:

    • Gentle cell lysis (e.g., French press or sonication with protease inhibitors)

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening for optimal solubilization (e.g., DDM, LDAO, Triton X-100)

  • Chromatography approach:

    • Initial IMAC purification using His-tag affinity

    • Secondary ion-exchange chromatography for higher purity

    • Optional size-exclusion chromatography as a final polishing step

    • All buffers should contain stabilizing agents (glycerol, specific ions) and appropriate detergent

  • Activity preservation strategies:

    • Maintain physiological pH throughout purification (typically pH 7.0-7.5)

    • Include stabilizing agents (10-15% glycerol)

    • Consider addition of ATP analogues to stabilize conformation

    • Avoid freeze-thaw cycles; store in single-use aliquots

Activity verification assays:

  • Autophosphorylation assay: Incubate purified PhoR with γ-32P-ATP and analyze by SDS-PAGE/autoradiography

  • Phosphotransfer assay: Measure transfer of phosphate from PhoR to purified PhoB

  • ATPase activity measurements: Quantify ATP hydrolysis rates

  • Circular dichroism: Verify proper protein folding and secondary structure

This comprehensive purification approach addresses the unique challenges of obtaining functional recombinant PhoR while preserving its native biochemical activities.

How can researchers effectively study the binding of PhoR to membrane components and interaction partners?

Studying PhoR's interactions with membrane components and protein partners requires specialized techniques that account for its membrane-associated nature:

Membrane interaction analysis techniques:

  • Lipid binding assays:

    • Liposome flotation assays with varying lipid compositions

    • Surface plasmon resonance (SPR) with immobilized lipid bilayers

    • Microscale thermophoresis (MST) with labeled PhoR and lipid vesicles

  • Detergent micelle studies:

    • Analytical ultracentrifugation to characterize PhoR-detergent complexes

    • Fluorescence spectroscopy with environment-sensitive probes

    • Hydrogen-deuterium exchange mass spectrometry to identify membrane-interacting regions

Protein-protein interaction methodologies:

  • In vitro interaction assays:

    • Pull-down assays using tagged versions of PhoR, PhoB, and PhoU

    • Bio-layer interferometry (BLI) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Förster resonance energy transfer (FRET) for detecting proximity in reconstituted systems

  • In vivo interaction studies:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Split fluorescent protein complementation

    • Chemical cross-linking followed by mass spectrometry

    • Co-immunoprecipitation from membrane fractions

  • Structural biology approaches:

    • Cryo-electron microscopy of PhoR-containing complexes

    • NMR studies of isolated domains and interactions

    • X-ray crystallography of soluble domains with interaction partners

Data integration strategies:

  • Combine multiple independent techniques to build confidence in interaction models

  • Correlate in vitro binding data with in vivo functional studies

  • Use computational modeling to integrate experimental constraints into structural models

These methodologies provide complementary approaches to characterize PhoR's interactions with both membrane components and protein partners, offering insights into the molecular mechanisms underlying phosphate sensing and signal transduction.

What are the best approaches to study the impact of PhoR mutations on phosphate sensing and signaling?

Investigating the functional consequences of PhoR mutations requires a multifaceted approach combining genetic, biochemical, and phenotypic analyses:

Mutation design strategies:

  • Targeted mutagenesis approaches:

    • Site-directed mutagenesis of known functional residues (e.g., His215 phosphorylation site)

    • Alanine-scanning mutagenesis of putative interaction interfaces

    • Domain swapping with homologous histidine kinases

    • Construction of chimeric proteins to identify domain functions

  • Random mutagenesis methods:

    • Error-prone PCR to generate mutation libraries

    • DNA shuffling for recombination-based diversity

    • Transposon-based insertion mutagenesis

Functional characterization methodologies:

  • In vivo phenotypic assays:

    • Growth rate measurements under varying Pi concentrations

    • Pi uptake assays to measure transport efficiency

    • Reporter gene assays using PHO box-controlled promoters

    • Quantitative RT-PCR of PHO regulon genes (glpQ1, pstS, phoR)

  • Biochemical activity assays:

    • Autophosphorylation assays with purified mutant proteins

    • Phosphotransfer efficiency to PhoB

    • ATP binding and hydrolysis measurements

    • Phosphatase activity toward phospho-PhoB

  • Protein-protein interaction analyses:

    • Co-immunoprecipitation to detect altered interactions with PhoB, PhoU, or Pst components

    • Bacterial two-hybrid assays with mutant variants

    • Surface plasmon resonance to quantify binding affinities and kinetics

Structural impact assessment:

  • Protein stability and folding:

    • Circular dichroism spectroscopy

    • Differential scanning fluorimetry (thermal shift assays)

    • Limited proteolysis to detect conformational changes

  • Computational analyses:

    • Molecular dynamics simulations to predict mutation effects

    • Homology modeling based on related histidine kinases

    • Evolutionary analysis to identify conserved vs. variable regions

This integrated approach allows researchers to connect specific amino acid changes to alterations in PhoR function, providing mechanistic insights into phosphate sensing and signal transduction pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.