Recombinant Phosphate transport system permease protein pstA (pstA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Phosphate Transport

PstA operates within the Pst system, which dominates Pi_i uptake in low-phosphate environments (<20 μM) . Key functional insights:

  • ATP-dependent transport: PstB hydrolyzes ATP to energize Pi_i translocation via the PstA/PstC channel .

  • Regulatory linkage: In Nostoc punctiforme, PstA-associated systems show redundancy, with compensatory upregulation of pstB2, pstB3, and pstB4 upon pstB1 deletion .

  • Kinetic properties: In Sinorhizobium meliloti, the PstSCAB system exhibits a Km_m of 0.2 μM and Vmax_{max} of 70 nmol/min/mg protein, highlighting high affinity and velocity .

Recombinant Expression and Purification

Recombinant PstA proteins are produced in heterologous systems for structural and functional studies. Key examples include:

OrganismHost SystemPurityTagApplicationSource
Mycoplasma genitaliumE. coli, Yeast, Mammalian≥85%NoneTransport mechanism studies
Xylella fastidiosaCell-free expression≥85%NoneStructural analysis
Mycobacterium tuberculosisE. coli≥85%His-tagMutagenesis assays

Key Research Findings

  • Mutational analysis: Site-directed mutagenesis in E. coli revealed that Arg-220 is essential for Pi_i transport but not for alkaline phosphatase regulation .

  • Overexpression effects: In N. punctiforme, pstB1 overexpression increased Pi_i uptake by 40%, demonstrating its functional role .

  • Compensatory mechanisms: Knockout of pstB1 in N. punctiforme induced a 3.5-fold increase in pstB2 and pstB3 expression, preserving Pi_i homeostasis .

Applications in Research

  • Mechanistic studies: Used to dissect Pi_i transport kinetics and regulatory pathways in proteobacteria and cyanobacteria .

  • Biotechnological engineering: Overexpression of PstA homologs enhances phosphate uptake in nutrient-scarce environments, aiding biofertilizer development .

  • Drug targeting: Investigating PstA inhibitors could disrupt bacterial phosphate metabolism, offering antimicrobial strategies .

Future Directions

  • Structural resolution: Cryo-EM studies of recombinant PstA could elucidate conformational changes during ATP hydrolysis.

  • Cross-species compatibility: Testing PstA homologs (e.g., Lactococcus lactis PstB1) in synthetic biology platforms for improved Pi_i sequestration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
pstA; YPO4115; y4129; YP_4022; Phosphate transport system permease protein PstA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Yersinia pestis
Target Names
pstA
Target Protein Sequence
MVTIDMRNDATLMESRRKKQAWRRQKNRIALVLSMATMLFGLFWLIWILFSTVTKGIDGM SLALFTEMTPPPNTAGGGLANAIAGSGLLILWATVIGTPLGIMAGIYLAEYGRKSWLAEV TRFINDILLSAPSIVVGLFVYTIVVAKMEHFSGWAGVIALALLQVPIVIRTTENMLKLVP DSLREAAYALGTPKWRMISAITLKASVSGILTGILLAIARIAGETAPLLFTSLSNQFWST DLTRPIANLPVTIFKFAMSPFAEWQNLAWAGVLLITLCVLLLNILARVIFAKKKH
Uniprot No.

Target Background

Function
This protein is part of a binding-protein-dependent transport system for phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: ype:YPO4115

STRING: 187410.y4129

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of PstA and how does it contribute to phosphate transport?

PstA is characterized by six transmembrane helices that span the cytoplasmic membrane, forming part of the pore through which phosphate ions move from the periplasm to the cytoplasm . These helices organize to create binding sites that facilitate phosphate movement through the membrane. The cytoplasmic portions of PstA interact with PstB, the ATP-binding component that energizes transport through ATP hydrolysis . PstA works in conjunction with PstC (another transmembrane component) to form the complete translocation channel, while PstS binds phosphate in the periplasm with high affinity and PstB provides energy through ATP hydrolysis . The specific arrangement of transmembrane domains creates a pathway that allows conformational changes necessary during the transport cycle as the protein alternates between outward-facing and inward-facing states.

How does PstA function within the complete Pst system during phosphate limitation?

In the complete Pst system, PstA functions as one of two integral membrane proteins (alongside PstC) that form the transmembrane channel for phosphate transport . This system operates as follows: The periplasmic protein PstS first binds inorganic phosphate in the periplasmic space. This phosphate-loaded PstS then interacts with the transmembrane complex formed by PstA and PstC . The cytoplasmic component PstB, which has ATPase activity, hydrolyzes ATP to provide energy for the conformational changes required to transport phosphate through the PstA/PstC channel into the cytoplasm . The system is particularly important when environmental phosphate falls below approximately 20 μM, at which point the Pst system is induced, allowing efficient phosphate scavenging from dilute environments . This high-affinity system enables bacteria to survive in phosphate-limited conditions, which are common in many natural environments.

How does PstA differ across bacterial species?

The PstA protein shows notable variations across different bacterial species, reflecting evolutionary adaptations to diverse ecological niches . In Escherichia coli, PstA is part of a single Pst system that is induced during phosphate limitation . In contrast, cyanobacteria like Synechocystis sp. strain PCC 6803 possess two distinct Pst systems (Pst1 and Pst2) that are differentially expressed depending on phosphate availability . Research on Nostoc punctiforme reveals even greater complexity, with multiple Pst phosphate uptake systems distributed across three distinct operons . These differences influence how each organism responds to phosphate limitation, with some species upregulating their Pst systems more rapidly or efficiently than others . The amino acid sequences of PstA can vary significantly between species, affecting substrate affinity, transport kinetics, and regulatory interactions. These variations are particularly important in environmental bacteria that must adapt to fluctuating phosphate levels in their habitats.

What expression systems are optimal for producing recombinant PstA?

For recombinant production of PstA, several expression systems have demonstrated success with membrane proteins like PstA :

  • E. coli expression systems: The most commonly used host for initial expression attempts, particularly strains lacking endogenous PstA for complementation studies. The pET expression system with T7 promoter is frequently utilized, with vectors like pET-28a(+) being successfully employed with His-tagging for detection and purification .

  • Alternative expression systems: For challenging membrane protein expression, yeast systems (Pichia pastoris), baculovirus expression systems with insect cells, or mammalian cell expression systems may provide advantages for proper folding and post-translational modifications .

Optimal expression conditions include induction with IPTG concentrations greater than 1 mM and significant expression observed after 6 hours of induction . The choice depends on experimental requirements, including the need for functional studies, structural analysis, or antibody production.

What purification strategies yield the highest purity and functionality of recombinant PstA?

Purification of membrane proteins like PstA requires specialized approaches to maintain protein integrity and function :

  • Membrane isolation: After cell lysis using methods like sonication, differential centrifugation separates membranes from cytosolic components .

  • Solubilization: The membrane fraction containing PstA must be solubilized using carefully selected detergents that maintain protein functionality.

  • Affinity chromatography: For His-tagged PstA, immobilized metal affinity chromatography (IMAC) using nickel resin is effective. The protocol typically involves incubating the solubilized protein with nickel medium for about 2 hours at 4°C .

  • Further purification: Size exclusion chromatography separates properly folded PstA from aggregates and impurities based on molecular size.

Throughout purification, maintaining cold temperature (4°C) and including protease inhibitors is crucial for preserving protein integrity . The purified protein should be assessed for purity using SDS-PAGE and Western blotting, with anti-His antibodies (1:2000 dilution) for detection of His-tagged recombinant protein .

How can I verify proper folding and membrane integration of recombinant PstA?

Verifying proper folding and membrane integration of recombinant PstA requires multiple complementary approaches:

  • Functional complementation assays: The ability of recombinant PstA to complement the function of a knockout mutant provides strong evidence of proper folding and integration. This approach has been successfully applied to other Pst system components .

  • Membrane fractionation: Subcellular fractionation followed by Western blotting can confirm that PstA is properly localized to the membrane fraction rather than forming inclusion bodies .

  • Transport assays: Direct measurement of phosphate transport activity in proteoliposomes or whole cells expressing the recombinant protein provides definitive evidence of proper folding and function .

  • Biophysical methods: Circular dichroism spectroscopy to assess secondary structure content and thermal stability assays to evaluate protein stability, which often correlates with proper folding.

  • Limited proteolysis: Properly folded membrane proteins often show distinctive patterns of resistance to proteolytic digestion compared to misfolded variants.

A multi-method approach is recommended, as no single technique can definitively establish proper folding and membrane integration of a complex membrane protein like PstA.

What methods are effective for studying PstA-mediated phosphate transport in vitro?

Several complementary approaches have proven effective for studying PstA-mediated phosphate transport in vitro:

  • Reconstituted proteoliposome assays: This approach involves purifying PstA along with other Pst system components and reconstituting them into artificial liposomes. Transport can then be measured by monitoring the uptake of radiolabeled phosphate into these liposomes.

  • Functional complementation assays: The ability of recombinant PstA to restore phosphate transport in PstA knockout bacterial strains provides evidence of functionality .

  • Radioisotope flux measurements: Using purified membrane vesicles from cells expressing recombinant PstA, phosphate transport can be measured using radioisotope tracers .

  • Fluorescent probe-based assays: Phosphate-sensitive fluorescent probes can be encapsulated in proteoliposomes to monitor transport in real-time without radioisotopes.

  • Surface plasmon resonance (SPR): This technique can study the interaction between purified PstA (incorporated into nanodiscs or supported lipid bilayers) and other components of the Pst system or potential inhibitors.

Each method has specific advantages and limitations, and a comprehensive understanding often requires combining multiple approaches based on the specific research question and available resources.

How can site-directed mutagenesis be applied to investigate functional domains of PstA?

Site-directed mutagenesis provides a powerful approach for investigating the functional domains of PstA:

  • Target selection methodology: Key residues for mutagenesis should be identified based on sequence conservation across species, predicted transmembrane segments, residues likely involved in phosphate binding or translocation, and positions that might interact with other Pst system components.

  • Mutagenesis strategies: Several approaches for creating mutations include:

    • Overlap PCR method: Creating two PCR fragments with overlapping ends containing the desired mutation, then combining them in a subsequent PCR reaction .

    • Point mutation techniques using plasmid linearization followed by homologous recombination .

  • Functional characterization: Effects of mutations can be assessed through:

    • Phosphate transport assays in reconstituted systems

    • Growth complementation studies in PstA knockout strains

    • Binding assays to measure phosphate affinity

    • Interprotein interaction studies to examine effects on complex formation

  • In vivo validation: Creating chromosomal mutations or deletions using lambda red homologous recombination techniques, as demonstrated in research with other Pst components .

This systematic approach can identify essential residues for phosphate recognition, translocation, energy coupling, and interactions with other Pst system components.

How can I design experiments to investigate the relationship between PstA and the PHO regulon?

The relationship between PstA and the PHO regulon represents a sophisticated regulatory loop in bacterial phosphate homeostasis that can be experimentally investigated through:

  • Gene expression analysis: Quantitative real-time PCR (qPCR) can be used to measure how PstA expression changes in response to varying phosphate concentrations and how these changes correlate with PHO regulon activity . Similar to studies with PstB1, these experiments should include time course measurements (e.g., over 64 hours) in cells cultured under different phosphate conditions .

  • Reporter gene constructs: Creating fusions between the PstA promoter region and reporter genes like GFP allows real-time monitoring of gene expression in response to changing phosphate conditions.

  • Genetic approaches: Creating specific mutations in PstA that disrupt either transport function or regulatory function can help dissect these dual roles. These mutants can be characterized for both phosphate transport and PHO regulon regulation.

  • Protein-protein interaction studies: Methods like bacterial two-hybrid systems or co-immunoprecipitation can identify interactions between the Pst system components (including PstA) and the PhoR-PhoB two-component regulatory system.

  • Phosphate uptake measurements: Correlating phosphate uptake activity with PHO regulon expression in various PstA mutants can reveal how these functions are mechanistically linked .

  • Cross-species complementation: Testing whether PstA from one bacterial species can functionally replace PstA in another species can reveal conserved and divergent aspects of phosphate regulation.

These approaches can help elucidate how PstA contributes to both phosphate transport and regulation of the PHO regulon, providing insights into this central coordinator of bacterial phosphate homeostasis.

How do mutations in PstA affect phosphate homeostasis and bacterial stress responses?

Mutations in PstA can have complex effects on phosphate homeostasis and stress responses in bacterial cells:

  • Transport kinetics alterations: Mutations in PstA can affect the affinity or maximum transport rate for phosphate uptake, directly impacting phosphate accumulation .

  • PHO regulon derepression: The Pst system serves a dual role in transport and regulation. Certain mutations in PstA can lead to constitutive expression of the PHO regulon even when phosphate is abundant, disrupting cellular phosphate balance .

  • Compensatory mechanisms: Mutations in one component often trigger compensatory changes in expression of other transporters. Similar to observations with PstB in N. punctiforme, when one component is knocked out, expression of related genes may increase to compensate, particularly during phosphate starvation .

  • Stress response coordination: The Pst system's regulatory role extends to stress response pathways that affect both biofilm formation and virulence factor expression. PstA mutations can disrupt these coordinated responses.

  • Polyphosphate metabolism effects: Mutations in PstA can indirectly affect polyphosphate synthesis and degradation, which serves as a phosphate reservoir in many bacteria. The search results mention studies involving ppk (polyphosphate kinase) in conjunction with phosphate transport .

Understanding these complex effects requires comprehensive approaches that combine genetic, biochemical, and physiological methods to fully characterize how PstA mutations affect cellular phosphate homeostasis and related stress responses.

What approaches can determine the stoichiometry and assembly of PstA within the complete Pst transporter complex?

Determining the stoichiometry and assembly of PstA within the complete Pst transporter complex requires specialized techniques for membrane protein complexes:

  • Co-expression and co-purification strategies: Expressing multiple Pst components with different affinity tags allows purification of intact complexes and assessment of component stoichiometry . The design of co-expression constructs should consider the natural operon organization, as the Pst systems exist across distinct operons in organisms like N. punctiforme .

  • Genetic tagging approaches: Using approaches like SNAP-tag, CLIP-tag, or fluorescent protein fusions to individual Pst components can help visualize complex assembly in living cells.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify specific residues involved in protein-protein interactions within the complex.

  • Single-particle cryo-electron microscopy: This technique can provide structural information about the intact complex, revealing the arrangement and stoichiometry of components.

  • Native mass spectrometry: Advanced methods can analyze intact membrane protein complexes after careful solubilization to determine component stoichiometry.

  • Functional complementation with mixed wild-type/mutant constructs: By creating systems with controlled ratios of wild-type and mutant components, the functional stoichiometry of the complex can be inferred.

  • FRET-based approaches: Förster resonance energy transfer between fluorescently labeled components can provide information about proximity and arrangement within the complex.

These methods can be combined to build a comprehensive understanding of how PstA assembles with other Pst components to form the functional phosphate transport complex.

How does PstA contribute to bacterial survival in phosphate-limited environments?

PstA plays a crucial role in bacterial survival during phosphate limitation through multiple mechanisms:

  • High-affinity phosphate uptake: As part of the Pst system, PstA contributes to a transport mechanism with high affinity for phosphate, allowing bacteria to scavenge phosphate efficiently from dilute environments. In E. coli, the Pst system is induced when external phosphate concentration falls below 20 μM .

  • Upregulation during starvation: Components of the phosphate transport system show increased expression during phosphate limitation, enhancing cellular capacity to acquire this essential nutrient. Similar to observations with PstB1 in N. punctiforme, PstA expression likely increases significantly in cells cultured without added phosphate .

  • Energy efficiency: Although the Pst system requires ATP for transport, its high affinity makes it energetically favorable under low phosphate conditions compared to less specific transporters.

  • PHO regulon coordination: The regulatory role of the Pst system ensures that phosphate scavenging, storage, and utilization systems are coordinately regulated, optimizing survival under stress conditions .

  • Adaptation to specific niches: Different bacterial species have evolved distinct arrangements of Pst system components, likely reflecting adaptation to their specific ecological niches and the phosphate fluctuations they encounter .

The redundancy of phosphate transport systems observed in organisms like N. punctiforme (with multiple operons) highlights the evolutionary importance of maintaining phosphate uptake capacity under diverse environmental conditions .

How can I resolve issues with low expression yields of recombinant PstA?

Addressing low expression yields of recombinant PstA requires a systematic troubleshooting approach:

  • Expression system optimization:

    • Try different E. coli strains specialized for membrane protein expression

    • Consider lower growth temperatures (16-25°C) to improve folding

    • Optimize induction conditions - significant expression has been observed after 6 hours with IPTG concentrations greater than 1 mM

  • Vector design improvements:

    • Include a strong ribosome binding site

    • Optimize codon usage for the host organism

    • Consider fusion partners that enhance expression

    • Use His-tagging for detection and purification as demonstrated in previous studies

  • Induction strategy optimization:

    • Test varying inducer concentrations and induction times

    • Consider using weaker promoters for slower, more controlled expression

    • Try auto-induction media instead of IPTG induction

  • Detection method verification:

    • Ensure the detection tag is accessible

    • Try alternative locations for the tag (N-terminal, C-terminal, or internal)

    • Use Western blotting with high sensitivity detection methods

The search results describe a successful Western blotting protocol using anti-His antibodies (1:2000 dilution) with secondary antibody (1:10000), which could be optimized further if detection is an issue .

What controls are essential when evaluating phosphate transport activity of recombinant PstA?

When evaluating phosphate transport activity of recombinant PstA, the following controls are essential for reliable and interpretable results:

  • Negative controls:

    • Empty vector-transformed cells or liposomes without protein insertion

    • Heat-inactivated PstA to control for non-specific phosphate binding

    • PstA mutants with critical residues altered to eliminate activity

    • Assays performed in the presence of known inhibitors of ABC transporters

  • Positive controls:

    • Wild-type PstA expressed under identical conditions

    • A well-characterized phosphate transporter with established activity

    • Functional complementation experiments in appropriate knockout strains

  • System completeness controls:

    • Assays with full Pst system (PstS, PstA, PstC, PstB) versus partial complexes

    • Assessment of proper complex formation using co-immunoprecipitation

    • Experiments with varying stoichiometry of components

  • Energy coupling controls:

    • Transport assays with and without ATP or ATP analogs

    • Experiments with ATP hydrolysis-deficient PstB to separate binding from transport

  • Technical controls:

    • Time-point samples to ensure linearity of transport during measurement period

    • Membrane integrity assessments to confirm vesicles or cells remain intact

    • Protein quantification to normalize transport rates to protein amount

    • Western blotting to confirm expression

  • Genetic complementation controls:

    • Functional rescue experiments in PstA knockout strains

    • Assessment of PHO regulon activity to confirm regulatory function

    • Methods for creating knockout strains using lambda red homologous recombination

Proper controls not only validate activity measurements but also help distinguish direct effects of PstA from indirect or non-specific phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.