Recombinant Phosphate transport system permease protein pstC (pstC)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant PstC is produced in heterologous systems (e.g., E. coli, yeast, mammalian cells) for structural and functional studies. Key characteristics include:

  • Host systems: E. coli is most common, but other hosts (e.g., Bacillus subtilis, Pasteurella multocida) are used for diverse applications .

  • Purity: Typically ≥85% as determined by SDS-PAGE .

  • Tags: His-tagged versions enable affinity purification (e.g., nickel-chelating chromatography) .

SpeciesHost SystemPurityTagApplication
Escherichia coliE. coli≥90%His-tagFunctional complementation
Pasteurella multocidaE. coli or yeast≥85%N/AELISA, Western blot
Bacillus subtilisE. coli≥85%His-tagStructural analysis

Key Mutational and Functional Studies

Mutagenesis has elucidated PstC’s role in phosphate transport and regulation:

  1. Residue-specific mutations:

    • Arg-237 → Gln or Glu-240 → Gln abolished phosphate uptake but retained repression of alkaline phosphatase, indicating a separation of transport and regulatory functions .

    • Proline substitutions: Disrupting proline pairs in transmembrane helices altered the Pst system’s conformational state. For example:

      • PstA proline mutations: Created a "permanently closed" system.

      • PstC proline mutations: Induced a "permanently open" state .

  2. Compensatory mechanisms: In Nostoc punctiforme, deletion of pstB1 (a PstB homolog) was compensated by upregulation of pstB2, pstB3, and pstB4, highlighting redundancy in phosphate uptake systems .

Applications in Research

Recombinant PstC is integral to studying phosphate transport mechanisms and their regulation:

  • Functional complementation: Overexpression of pstB1 in N. punctiforme or E. coli PstB mutants restored phosphate uptake, confirming its role in ATP-dependent transport .

  • Structural analysis: Probing transmembrane helix interactions and nucleotide-binding site dynamics in PstB via mutagenesis .

  • Agricultural and biotechnological relevance: Insights into cyanobacterial phosphate acquisition inform biofertilizer development and nutrient cycling models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
pstC; Z5218; ECs4663; Phosphate transport system permease protein PstC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
pstC
Target Protein Sequence
MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLMLGGIIVSLIISSWPSIQKFGLAFLWTK EWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLA AIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIM IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALG ETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFI VLAASKFMIMRLAKNEGAR
Uniprot No.

Target Background

Function
This protein plays a crucial role in the binding-protein-dependent transport system for phosphate. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: ece:Z5218

STRING: 155864.Z5218

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of PstC in bacterial phosphate transport?

PstC functions as an integral membrane protein containing six transmembrane helices that forms part of the transmembrane (TM) channel responsible for phosphate transport across the cytoplasmic membrane in bacteria. It works in conjunction with PstA (another membrane-spanning protein) to create the structural channel through which inorganic phosphate (Pi) moves into the cell. The Pst system typically comprises one periplasmic substrate binding protein (PstS), two membrane-bound components (PstA and PstC), and the cytosolic PstB that energizes phosphate release in the cytoplasm .

The functional importance of PstC is demonstrated by studies showing that mutations in the pstC gene significantly affect the ability of the Pst system to transport phosphate without necessarily affecting the regulation of other phosphate-related genes such as phoA .

How does PstC interact with other components of the Pst system?

PstC interacts closely with PstA to form the transmembrane channel of the Pst system. The cytoplasmic sides of both PstC and PstA connect to PstB, which is responsible for ATP hydrolysis that provides the energy needed for the transmembrane channel to function effectively as a phosphate transporter .

In the complete phosphate transport process, PstS first binds phosphate in the periplasm. This phosphate-loaded PstS then interacts with the PstC/PstA channel complex, allowing phosphate to move through the membrane. The energy for this transport comes from PstB-mediated ATP hydrolysis, which causes conformational changes in the PstC/PstA complex that facilitate phosphate movement into the cytoplasm .

How is PstC expression regulated in response to phosphate availability?

The expression of PstC, along with other components of the Pst system, is typically upregulated under phosphate-limiting conditions. This regulation is part of the cellular response to phosphate starvation and is controlled by the pho regulon .

In bacteria like Synechocystis sp. strain PCC 6803, which contains two distinct Pst systems (Pst1 and Pst2), differential expression occurs depending on extracellular phosphate levels. Research has shown that the primary transport of phosphate depends on the Pst1 system under normal conditions, while the Pst2 system's contribution becomes significant only under low phosphate levels .

What methodologies are most effective for studying PstC function in different bacterial species?

For studying PstC function across bacterial species, several complementary approaches have proven effective:

  • Gene Knockout and Complementation Studies: Creating PstC knockout mutants followed by complementation with recombinant PstC can reveal its functional importance. This approach was successfully used in Nostoc punctiforme to study related phosphate transport components .

  • Quantitative Real-Time PCR (qPCR): This technique helps measure changes in pstC expression under varying phosphate concentrations. For instance, studies on PstB1 in N. punctiforme utilized qPCR to determine that mRNA levels increased significantly over 64 hours in phosphate-starved cells and decreased in high-phosphate conditions .

  • Functional Complementation in Heterologous Systems: Expression of recombinant PstC in model organisms like E. coli with mutations in their native phosphate transport systems can demonstrate functional conservation. This approach confirmed that PstB1 from N. punctiforme could functionally complement PstB-deficient E. coli strains .

  • Phosphate Uptake Assays: Quantitative measurement of phosphate uptake in wild-type versus PstC mutant strains provides direct evidence of PstC's role in phosphate transport efficiency.

How do mutations in the pstC gene affect phosphate homeostasis and bacterial physiology?

Mutations in the pstC gene can significantly impact phosphate transport without necessarily affecting regulatory pathways in the pho regulon. Research indicates that pstC mutations primarily reduce the efficiency of phosphate transport by affecting the membrane insertion or channel formation capability of the Pst system .

The physiological consequences of pstC mutations can include:

  • Decreased phosphate uptake capacity, particularly under phosphate-limited conditions

  • Altered growth rates in phosphate-restricted environments

  • Potential compensatory upregulation of alternative phosphate acquisition systems

  • Changes in cellular phosphate storage mechanisms

Interestingly, studies in cyanobacteria reveal that redundancy in phosphate transport components may provide resilience against the loss of individual components. For example, in N. punctiforme, deletion of pstB1 did not significantly affect phosphate accumulation due to compensatory expression changes in pstB2, pstB3, and pstB4 .

What are the structural determinants of PstC that influence phosphate binding and transport specificity?

The key structural determinants of PstC that influence its function include:

  • Transmembrane Helices: The six transmembrane helices of PstC create a part of the channel through which phosphate moves. The specific arrangement and amino acid composition of these helices determine the channel properties .

  • Cytoplasmic Domains: The regions that interact with PstB are critical for coupling ATP hydrolysis to phosphate movement through conformational changes.

  • Periplasmic Loops: These regions likely interact with the phosphate-loaded PstS protein and may influence the specificity of the transport system.

  • Conserved Motifs: Specific amino acid sequences conserved across bacterial species often indicate functionally critical regions for phosphate recognition or transport.

Research approaches to identify these structural determinants include site-directed mutagenesis of conserved residues, chimeric protein construction between different Pst systems, and structural biology techniques to determine three-dimensional arrangements.

What expression systems are optimal for producing recombinant PstC for structural and functional studies?

Producing functional recombinant PstC presents challenges due to its nature as a membrane protein. The following expression systems have particular advantages for different research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, well-established protocols, cost-effectiveMay form inclusion bodies, potential folding issuesMutational studies, antibody production
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesLower yield, higher costRapid screening, toxic variants
Yeast (P. pastoris)Post-translational modifications, better folding of membrane proteinsLonger production time, glycosylation differencesStructural studies requiring proper folding
Insect cellsSuperior folding for complex membrane proteinsExpensive, technically demandingHigh-resolution structural analyses

For functional studies, E. coli strains specifically designed for membrane protein expression (such as C41/C43 or Lemo21) often provide the best balance of yield and proper folding. For structural studies requiring large amounts of properly folded protein, insect cell expression systems may be preferable despite their higher cost and technical complexity.

What are the most reliable assays for measuring PstC-mediated phosphate transport activity?

Several complementary assays can be employed to measure PstC-mediated phosphate transport:

  • Radioactive Phosphate Uptake: Using ^32P-labeled inorganic phosphate to directly measure transport rates in cells or reconstituted systems. This approach provides quantitative data on transport kinetics and is particularly useful for comparing wild-type and mutant PstC variants.

  • Reconstituted Proteoliposome Assays: Purified recombinant PstC (along with other Pst components) can be reconstituted into liposomes to create a minimal system for studying transport mechanisms without cellular complications.

  • Growth Complementation: Functional complementation of phosphate transport-deficient bacterial strains, similar to the approach used with PstB1 from N. punctiforme complementing E. coli PstB knockout mutants .

  • Fluorescent Phosphate Analogs: Using fluorescently labeled phosphate analogs to track transport in real-time through fluorescence microscopy or spectroscopy.

The most comprehensive approach combines multiple assays to overcome the limitations of any single method, particularly when studying structure-function relationships or comparing PstC variants.

How can researchers effectively study the interaction between PstC and other components of the Pst system?

To study the interactions between PstC and other Pst system components, researchers can employ these methodologies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against PstC or epitope-tagged versions to pull down protein complexes and identify interacting partners.

  • Bacterial Two-Hybrid Assays: Modified for membrane proteins, these can identify specific domains involved in protein-protein interactions within the Pst system.

  • FRET/BRET Analysis: Fluorescence or bioluminescence resonance energy transfer between tagged Pst components can demonstrate proximity and interaction in living cells.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify specific residues involved in interactions between PstC and other Pst components.

  • Genetic Suppressor Screens: Identifying mutations in one component that suppress the effects of mutations in another component can reveal functional interactions within the Pst system.

When designing these experiments, it's crucial to consider the membrane-embedded nature of PstC and how experimental manipulations might affect its native structure and interactions.

How should researchers interpret discrepancies in PstC function across different bacterial species?

When analyzing functional differences in PstC across bacterial species, researchers should consider:

  • Evolutionary Context: Differences may reflect adaptation to specific ecological niches with varying phosphate availability. For example, cyanobacteria like N. punctiforme have evolved redundant phosphate transport systems across three distinct operons, likely reflecting adaptation to environments with fluctuating phosphate levels .

  • System Redundancy: Some species have multiple Pst systems with specialized functions. Synechocystis sp. strain PCC 6803 contains two Pst systems (Pst1 and Pst2) that are differentially expressed based on phosphate availability .

  • Methodological Considerations: Apparent functional differences may stem from experimental approach variations rather than true biological differences.

  • Regulatory Context: The broader regulatory networks controlling PstC expression and activity may differ between species, affecting apparent function.

A standardized experimental approach across multiple species, including phosphate uptake kinetics under identical conditions, can help distinguish true functional differences from methodological artifacts.

What statistical approaches are most appropriate for analyzing phosphate transport data in PstC studies?

For rigorous analysis of phosphate transport data, consider these statistical approaches:

  • Enzyme Kinetics Modeling: Apply Michaelis-Menten or similar models to determine Km and Vmax parameters for phosphate transport, allowing quantitative comparison between wild-type and mutant PstC variants.

  • Multiple Condition Comparisons: When comparing PstC function under different conditions (e.g., varying phosphate concentrations), use ANOVA with appropriate post-hoc tests rather than multiple t-tests to maintain statistical power.

  • Time-Series Analysis: For phosphate uptake over time, consider repeated measures ANOVA or mixed-effects models that account for the non-independence of measurements.

  • Meta-Analysis Approaches: When comparing PstC function across studies or bacterial species, meta-analysis techniques can help identify consistent patterns despite methodological differences.

The Statistical Consulting Center (SCC) services mentioned in search result can provide additional guidance on experimental design and statistical analysis for complex PstC functional studies.

How might systems biology approaches enhance our understanding of PstC function in the context of cellular phosphate homeostasis?

Systems biology approaches offer powerful tools for understanding PstC within the broader context of cellular phosphate regulation:

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data can reveal how PstC expression correlates with global cellular responses to phosphate availability.

  • Network Analysis: Constructing interaction networks that include PstC and other phosphate homeostasis components can identify unexpected functional connections and regulatory hubs.

  • Mathematical Modeling: Developing quantitative models of phosphate transport and utilization can predict system behaviors under conditions difficult to test experimentally.

  • Single-Cell Analysis: Investigating cell-to-cell variability in PstC expression and function can reveal stochastic aspects of phosphate transport regulation not apparent in population-level studies.

These approaches could be particularly valuable for understanding the complex compensatory mechanisms observed in organisms like N. punctiforme, where deletion of one phosphate transport component led to expression changes in related genes .

What emerging technologies might advance structural and functional studies of PstC?

Several emerging technologies show promise for advancing PstC research:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM resolution make it increasingly feasible to determine high-resolution structures of membrane protein complexes like the Pst system in their native lipid environment.

  • Native Mass Spectrometry: This technique can determine the stoichiometry and interactions within intact membrane protein complexes.

  • Advanced Microscopy Techniques: Single-molecule tracking approaches can visualize PstC dynamics in living cells, potentially revealing functional states not detectable in bulk assays.

  • CRISPR-Based Approaches: CRISPR interference or activation systems offer precise temporal control over PstC expression, allowing detailed investigation of expression dynamics and cellular responses.

  • Microfluidic Systems: Devices that create defined gradients of phosphate can reveal how PstC function adapts to varying phosphate availability at the single-cell level.

These technologies could address key knowledge gaps, particularly regarding the dynamic assembly and disassembly of the Pst transport complex under changing phosphate conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.