Recombinant Phosphatidylcholine:ceramide cholinephosphotransferase 4 (SLS4)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics

PropertyValue/DescriptionSource
EC Number2.7.8.27
Gene NameSLS4
Protein Length365 amino acids
Molecular Weight~40.8 kDa
Expression SystemE. coli (N-terminal 10xHis-tagged)
Theoretical pI7.443

SLS4 is synthesized as a full-length recombinant protein with a His-tag for purification. Its bidirectional activity is dependent on the relative concentrations of DAG and ceramide, serving as critical phosphocholine acceptors .

Catalytic Activity

SLS4 operates via a transferase mechanism, transferring the cholinephosphate group between glycerophospholipids and ceramide. The reaction is bidirectional:

  • Forward Direction: PC + ceramide → SM + DAG

  • Reverse Direction: SM + DAG → PC + ceramide

This reversibility allows SLS4 to dynamically regulate sphingolipid and glycerophospholipid pools, particularly in Trypanosoma, where SM synthesis is vital for membrane integrity .

Substrate Specificity

  • Donor: Phosphatidylcholine (PC)

  • Acceptors: Ceramide (forward) or DAG (reverse)

  • Recognition Requirements:

    • Strict specificity for the choline head group on PC .

    • Requires two fatty chains on the choline-P donor for efficient recognition .

Critical Function in Trypanosoma brucei brucei

SLS4 is indispensable for the viability of the bloodstream-stage parasite. Its disruption leads to:

  • Ceramide Accumulation: Impaired SM synthesis causes toxic ceramide buildup, destabilizing the endoplasmic reticulum (ER) and Golgi .

  • Structural Collapse: ER exit sites and Golgi fragmentation, disrupting sphingolipid biosynthesis .

Comparative Enzyme Activities

EnzymeActivity ProfileSource
SLS4Bidirectional SM synthase (PC ↔ ceramide)
SMS2Mammalian SM synthase; also exhibits PC-PLC and PE-PLC activities
SMSrCeramide phosphoethanolamine synthase (CPE); regulates ER ceramide levels

Unlike mammalian sphingomyelin synthases (SMS1/2), SLS4 lacks phospholipase C (PLC) activity and is specialized for SM/DAG interconversion .

Experimental Uses

ApplicationDescriptionSource
Sphingolipid Metabolism StudiesUsed in assays to monitor SM/DAG interconversion in Trypanosoma.
Drug Target ScreeningSLS4 is a potential therapeutic target for African trypanosomiasis.

Recombinant SLS4 is commercially available as a purified protein (e.g., CSB-CF458999TQV) for use in enzymatic assays and structural studies .

SLS4 vs. Mammalian SMS Isoforms

FeatureSLS4 (Trypanosoma)SMS1/2 (Mammalian)
Primary FunctionSM/DAG interconversionSM synthesis
PLC ActivityAbsentPresent (SMS2)
Subcellular LocationLikely ER/Golgi-associatedPlasma membrane-associated
Pathogenic RoleEssential for survivalLinked to metabolic diseases

SLS4’s bidirectional activity contrasts with mammalian SMS isoforms, which primarily synthesize SM and are implicated in diseases like atherosclerosis and cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
SLS4; Phosphatidylcholine:ceramide cholinephosphotransferase 4; TbSLS4; Ethanolamine-phosphorylceramide synthase; EPC synthase; Sphingomyelin synthase; SM synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Trypanosoma brucei brucei
Target Names
SLS4
Target Protein Sequence
MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLFRSAV IVMTSLPAPDDLCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWWPCCGANSREVTEDSQPVMVAFKSEELDEMNGVLEGRQKKHGGVGDGESLMFK CGAYV
Uniprot No.

Target Background

Function
This protein is a bidirectional lipid cholinephosphotransferase capable of converting inositol phosphorylceramide (IPC) to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. The direction of the reaction depends on the relative concentrations of DAG and ceramide as phosphocholine acceptors. It specifically recognizes the choline head group on the substrate. Moreover, it requires two fatty chains on the choline-P donor molecule for efficient substrate recognition. This protein does not function strictly as a SM synthase. It is essential for the viability of the pathogenic bloodstream stage of this human protozoan parasite, making it a potential drug target.
Protein Families
Sphingomyelin synthase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the enzymatic function of SLS4 and how does it relate to other sphingomyelin synthases?

SLS4 belongs to the sphingomyelin synthase family, catalyzing the reversible transfer of phosphocholine from phosphatidylcholine (PC) to ceramide, forming sphingomyelin (SM) and diacylglycerol (DAG). Similar to SMS1 and SMS2, SLS4 appears to function as a ceramide:phosphatidylcholine cholinephosphotransferase (EC 2.7.8.27). The reaction catalyzed involves two substrates (ceramide and phosphatidylcholine) and yields two products (sphingomyelin and 1,2-diacyl-sn-glycerol) . Like other SMS family members, SLS4 likely recognizes the choline head group on its substrates, as demonstrated with SMS1 and SMS2 .

Additionally, SLS4 appears to exhibit multiple enzymatic activities beyond sphingomyelin synthesis, potentially including phosphatidylcholine-phospholipase C (PC-PLC), phosphatidylethanolamine-phospholipase C (PE-PLC), and ceramide phosphoethanolamine synthase (CPES) activities, as observed with other SMS family members . The enzymatic reaction may proceed via a charge-relay system involving histidine and aspartate residues, as proposed for related enzymes .

What structural features characterize SLS4 and how do they influence its catalytic activities?

Based on homology with other SMS family members, SLS4 likely exhibits a hexameric organization similar to SMSr or forms stable dimers like SMS1 and SMS2 . The enzyme is predicted to contain six transmembrane helices with a sizable chamber within the helical bundle that serves as the catalytic site . The catalytic domain likely contains a catalytic pentad denoted as E-H/D-H-D, strategically positioned at the interface between lipophilic and hydrophilic environments .

The transmembrane domains of SLS4 likely determine its subcellular localization and substrate accessibility, which directly impact its enzymatic activities. The structural organization enables SLS4 to access both lipid substrates (phosphatidylcholine and ceramide) within the membrane environment while orienting the catalytic residues properly for phosphocholine transfer .

How should I design an in vitro assay to accurately measure the multiple enzymatic activities of SLS4?

For a comprehensive analysis of SLS4's multiple enzymatic activities, design an assay system that can differentiate between SMS, PC-PLC, PE-PLC, and CPES activities:

  • Substrate preparation: Use defined phospholipid-detergent mixed micelles containing specific substrates:

    • For SMS activity: Ceramide + PC

    • For PC-PLC activity: PC only

    • For PE-PLC activity: PE only

    • For CPES activity: Ceramide + PE

  • Assay conditions: Maintain near-native environments by reconstituting purified SLS4 in detergent-free proteoliposomes. For initial screening, use approximately 2 mol% ceramide and 4 mol% PC (1:2 ratio) to optimize detection of PC-PLC activity .

  • Detection methods: Implement LC-MS/MS-based enzyme activity assays to detect multiple products simultaneously (sphingomyelin, DAG, phosphocholine, CPE) . Alternatively, use fluorescently labeled substrates (e.g., NBD-ceramide, NBD-DAG) for TLC-based detection .

  • Activity differentiation: To distinguish reverse activity, incubate extracts containing SLS4 with NBD-DAG and monitor NBD-PC formation by TLC in the presence of SM or PC as phosphocholine donors .

  • Controls: Include assays without ceramide to specifically measure PLC activities, and assays without phospholipids to confirm ceramide dependency for SM/CPE production .

What are the critical parameters for optimizing recombinant SLS4 expression and purification?

To optimize recombinant SLS4 expression and purification:

  • Expression system selection:

    • For functional studies: Use mammalian expression systems (HEK293, CHO) to ensure proper folding and post-translational modifications

    • For structural studies: Consider insect cell expression systems which often provide higher yields for membrane proteins

  • Construct design:

    • Include affinity tags (His, FLAG, or TS-tag) at the C-terminus rather than N-terminus to minimize interference with membrane insertion

    • Consider removing putative disordered regions for crystallography or cryo-EM studies

    • Ensure inclusion of all transmembrane domains to maintain native conformation

  • Membrane protein solubilization:

    • Test multiple detergents (DDM, LMNG, digitonin) to identify optimal solubilization conditions

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Purification strategy:

    • Implement two-step affinity purification followed by size exclusion chromatography

    • Maintain lipid content during purification to preserve enzyme activity

    • Include protease inhibitors and reducing agents throughout purification

  • Quality control:

    • Verify protein homogeneity using SDS-PAGE and size-exclusion chromatography

    • Confirm enzymatic activity at each purification step using the assays described above

    • Validate protein folding using circular dichroism or thermal shift assays

How can I investigate SLS4's substrate selectivity for different fatty acid-containing phospholipids?

To investigate SLS4's substrate selectivity for different fatty acid-containing phospholipids:

  • Substrate preparation: Create a panel of phospholipid substrates varying in:

    • Fatty acid chain length (short, medium, long)

    • Degree of saturation (saturated, monounsaturated, polyunsaturated)

    • Position of fatty acids (sn-1 vs. sn-2)

  • Competition assays: Perform competitive substrate assays using mixtures of PC species with different fatty acid compositions. Based on SMS2 data, expect potential preference for saturated fatty acid (SFA) and monounsaturated fatty acid (MUFA) containing PC and PE species over polyunsaturated fatty acid (PUFA) containing species .

  • Lipidomic analysis: Use LC-MS/MS to quantify product formation from different substrates. This approach enables identification of preferred substrates based on reaction rates and enzyme efficiency .

  • Kinetic parameters determination: Determine Km and Vmax values for each substrate type to quantitatively compare substrate preferences. Plot these parameters against physical properties of substrates (chain length, saturation index) .

  • Structural correlation: Correlate substrate preferences with structural features of SLS4's binding pocket, potentially informed by homology models based on related enzymes .

The methodology should control for substrate presentation (micelles vs. liposomes), detergent effects, and membrane fluidity to ensure reliable results.

What approaches can identify inhibitors of SLS4 and characterize their mechanisms of action?

To identify and characterize SLS4 inhibitors:

  • Inhibitor screening strategy:

    • Test known SMS inhibitors such as D609, which inhibits SMS, PC-PLC, PE-PLC, and CPES activities of SMS2

    • Screen for divalent cation effects, particularly Zn²⁺, which strongly inhibits all enzymatic activities of SMS2

    • Investigate product-mediated feedback inhibition, as diacylglycerol inhibits the SMS activity of SMS2

  • Mechanism determination:

    Inhibitor TypeAssay ApproachExpected OutcomeAnalysis Method
    CompetitiveVary substrate concentration with fixed inhibitorIncreased Km, unchanged VmaxLineweaver-Burk plot
    Non-competitiveFixed substrate with varying inhibitorDecreased Vmax, unchanged KmDixon plot
    MixedMultiple substrate and inhibitor concentrationsChanges in both Km and VmaxGlobal fit analysis
  • Structure-activity relationship (SAR) studies:

    • Synthesize structural analogs of lead inhibitors

    • Correlate chemical modifications with inhibitory potency

    • Develop pharmacophore models for rational design of improved inhibitors

  • Cellular validation:

    • Confirm inhibitor efficacy in cellular systems using metabolic labeling

    • Monitor effects on sphingolipid metabolism and signaling pathways

    • Assess specificity using knockout/knockdown models

  • Binding site identification:

    • Use site-directed mutagenesis of catalytic residues

    • Perform photoaffinity labeling or hydrogen-deuterium exchange mass spectrometry

    • Conduct molecular docking simulations based on homology models

What methodologies effectively distinguish between SLS4's multiple enzymatic activities in cellular contexts?

To distinguish between SLS4's multiple enzymatic activities in cellular contexts:

  • Metabolic labeling approaches:

    • Use isotope-labeled precursors specific to each pathway:

      • [³H]-choline to trace SMS and PC-PLC activities

      • [³H]-ethanolamine to trace CPES and PE-PLC activities

      • [³H]-sphingosine to trace sphingolipid synthesis

  • Activity-specific inhibition:

    • Apply D609 at varying concentrations to differentially inhibit PC-PLC and SMS activities

    • Use Zn²⁺ to inhibit all enzymatic activities as a positive control

    • Employ ceramide analogs that selectively interfere with sphingolipid synthesis without affecting PLC activity

  • Substrate manipulation:

    • Deplete cellular ceramide using sphingolipid synthesis inhibitors to eliminate SMS/CPES activities

    • Supplement cells with specific lipid species to drive particular reactions

    • Use substrate analogs with reporter groups (fluorescent, clickable) to track specific pathways

  • Genetic approaches:

    • Generate catalytic mutants that selectively disrupt specific activities

    • Employ CRISPR-Cas9 to introduce point mutations in the catalytic site

    • Create chimeric proteins with domains from related enzymes to alter activity profiles

  • Compartment-specific analysis:

    • Use subcellular fractionation to isolate membrane compartments

    • Employ targeted mass spectrometry to measure lipid changes in specific organelles

    • Develop organelle-specific lipid sensors to monitor product formation in situ

How can I analyze the impact of SLS4 on cellular lipid homeostasis and signaling pathways?

To analyze SLS4's impact on cellular lipid homeostasis and signaling pathways:

  • Lipidomic profiling:

    • Perform comprehensive lipidomic analysis following SLS4 overexpression or knockdown

    • Quantify changes in key lipid species including sphingomyelin, ceramide, DAG, PC, and PE

    • Monitor fatty acid composition changes in these lipid classes

  • Signaling pathway analysis:

    • Examine effects on DAG-responsive proteins such as Protein Kinase C and Protein Kinase D1

    • Investigate ceramide-mediated apoptotic signaling

    • Assess sphingomyelin's role in membrane raft formation and receptor-mediated signaling

  • Subcellular distribution studies:

    • Analyze lipid compositions of plasma membrane vs. Golgi apparatus

    • Monitor effects on membrane raft integrity using detergent resistance assays

    • Track changes in membrane fluidity and protein organization

  • Functional readouts:

    • Measure cell proliferation, differentiation, and apoptosis rates

    • Assess receptor clustering and signaling efficiency

    • Evaluate secretory pathway function, particularly at the Golgi apparatus

  • Temporal dynamics:

    • Implement pulse-chase experiments to track lipid metabolism kinetics

    • Use optogenetic approaches to acutely modulate SLS4 activity

    • Develop real-time lipid sensors to monitor dynamic lipid changes

What approaches can reveal mechanistic insights into SLS4's bidirectional enzymatic activity?

To investigate the bidirectional activity of SLS4:

  • Equilibrium studies:

    • Establish reaction conditions that favor forward vs. reverse reactions

    • Determine how substrate/product ratios influence reaction direction

    • Identify factors that shift equilibrium between SM synthesis and breakdown

  • Structure-function analysis:

    • Create site-directed mutants targeting the catalytic pentad (E-H/D-H-D)

    • Test how mutations affect forward vs. reverse reaction rates

    • Develop homology models based on related enzymes to predict structural transitions

  • Real-time kinetics:

    • Implement stopped-flow kinetics with fluorescent substrates

    • Measure reaction rates under various substrate concentrations

    • Develop mathematical models of the reaction mechanism

  • Cellular manipulation:

    • Design experiments that alter cellular DAG/ceramide ratios to drive specific reaction directions

    • Use pharmacological tools to perturb lipid levels and monitor effects on reaction direction

    • Create cellular systems with inducible expression of SLS4 to observe acute effects

  • Comparative enzymology:

    • Compare SLS4 with SMS1 and SMS2 regarding their preference for forward vs. reverse reactions

    • Investigate whether their differing subcellular localizations influence reaction direction

    • Examine species differences in reaction directionality and regulation

SMS1 and SMS2 have demonstrated the ability to function as transferases capable of using both PC and SM as phosphocholine donors, with the direction dependent on the relative concentrations of DAG and ceramide . Similar mechanisms may govern SLS4's bidirectional activity.

How can I apply high-throughput approaches to study SLS4 in pathophysiological contexts?

To apply high-throughput approaches for studying SLS4 in pathophysiological contexts:

  • CRISPR screening platforms:

    • Design genome-wide CRISPR screens to identify genetic interactions with SLS4

    • Create focused libraries targeting lipid metabolism and signaling genes

    • Implement synthetic lethality screens to identify context-dependent vulnerabilities

  • Compound library screening:

    • Develop fluorescence-based high-throughput assays for SLS4 activity

    • Screen chemical libraries to identify novel modulators

    • Validate hits using orthogonal biochemical and cellular assays

  • Patient-derived models:

    • Analyze SLS4 expression and activity in disease-relevant tissues

    • Create patient-derived organoids to study tissue-specific effects

    • Correlate sphingolipid profiles with disease progression and outcomes

  • Multi-omics integration:

    • Combine lipidomics, transcriptomics, and proteomics data

    • Identify context-specific regulatory networks

    • Develop predictive models of SLS4's role in disease pathogenesis

  • Functional imaging:

    • Implement high-content imaging to track lipid dynamics in real-time

    • Develop FRET-based sensors for sphingolipid metabolism

    • Apply advanced microscopy techniques to monitor membrane organization changes

The relevance of such approaches is supported by findings that sphingomyelin synthases regulate receptor-mediated signal transduction via mitogenic DAG and proapoptotic ceramide, as well as sphingomyelin's role as a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting .

What are the common pitfalls in SLS4 activity assays and how can they be addressed?

Common pitfalls in SLS4 activity assays and their solutions include:

  • Substrate presentation issues:

    • Problem: Improper substrate incorporation into micelles or liposomes

    • Solution: Standardize micelle/liposome preparation protocols; verify substrate incorporation using dynamic light scattering; optimize detergent:lipid ratios

  • Enzyme stability challenges:

    • Problem: Loss of activity during purification and storage

    • Solution: Include stabilizing lipids throughout purification; avoid freeze-thaw cycles; store enzyme in glycerol-containing buffers at -80°C in single-use aliquots

  • Assay interference factors:

    • Problem: Reagents or buffer components inhibiting enzymatic activity

    • Solution: Systematically test buffer components; avoid metal chelators that may sequester required ions; perform substrate blank controls

  • Product detection limitations:

    • Problem: Low sensitivity or specificity in product detection

    • Solution: Implement internal standards for quantification; use multiple detection methods (LC-MS/MS and TLC) for validation; optimize extraction procedures for complete recovery

  • Activity differentiation difficulties:

    Activity TypeCommon IssueRecommended Solution
    SMS vs. PC-PLCDistinguishing source of DAGUse ceramide-free controls
    Forward vs. ReverseSimilar products formedTrack isotope-labeled substrates
    CPES vs. PE-PLCLow CPES activityOptimize PE:ceramide ratios
    Multiple activitiesOverlapping signalsUse specific inhibitors differentially

How can I ensure reproducibility and reliability in SLS4 research across different experimental platforms?

To ensure reproducibility and reliability in SLS4 research:

  • Standardization of enzyme sources:

    • Define expression systems and purification protocols in detail

    • Characterize enzyme preparations by specific activity measurements

    • Establish quality control criteria for protein purity and homogeneity

  • Assay validation approaches:

    • Implement positive and negative controls in all experiments

    • Validate new assays against established methods

    • Determine assay precision, accuracy, and linear range

  • Reference standards development:

    • Create stable reference materials for activity calibration

    • Establish standard operating procedures for key assays

    • Develop consensus protocols for multi-laboratory validation

  • Data reporting guidelines:

    • Report all assay conditions in sufficient detail for replication

    • Include raw data and detailed statistical analyses

    • Document all software and algorithms used for data processing

  • Physiological relevance considerations:

    • Compare in vitro findings with cellular systems

    • Validate key findings across multiple cell types

    • Establish correlation between enzymatic parameters and biological outcomes

Adherence to these practices will enhance the reliability of research on SLS4 and related sphingolipid synthases, facilitating better understanding of their roles in cellular lipid homeostasis and signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.