Recombinant Phosphatidylglycerophosphatase B (pgpB)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activities and Substrate Specificity

Recombinant PgpB demonstrates broad substrate specificity, as shown in biochemical assays:

SubstrateSpecific Activity (μmol/min/mg)OrganismSource
PGP54.7 ± 4.6B. subtilis
Diacylglycerol diphosphate19.5 ± 4.3B. subtilis
Undecaprenyl pyrophosphate12.5 ± 3.6B. subtilis
Lysophosphatidic acidDetected (no quantification)E. coli

Key findings:

  • PGP is the preferred substrate, with bsPgpB showing 328-fold higher activity than wild-type B. subtilis when overexpressed .

  • Undecaprenyl pyrophosphate phosphatase activity enables recycling of lipid carriers for peptidoglycan biosynthesis .

Functional Roles in Cell Envelope Biogenesis

Recombinant PgpB contributes to:

  • Phospholipid biosynthesis: Converts phosphatidylglycerol phosphate (PGP) to phosphatidylglycerol (PG), a major membrane lipid .

  • Peptidoglycan recycling: Dephosphorylates C55-PP to regenerate undecaprenyl phosphate (C55-P), essential for cell wall synthesis .

  • Antibiotic resistance: In Acinetobacter baumannii, PgpB disruption alters peptidoglycan structure and increases carbapenem susceptibility .

Functional Complementation

  • bsPgpB restores viability in E. coli strains lacking endogenous C55-PP phosphatases, demonstrating cross-species functionality .

Synthetic Lethality

  • E. coli pgpB is synthetically lethal with bacA ybjG mutants due to overlapping roles in lipid carrier metabolism .

Implications for Antimicrobial Development

  • Target validation: PgpB’s role in PG synthesis and cell wall integrity makes it a candidate for disrupting Gram-negative pathogens .

  • Substrate-specific inhibition: Structural models enable rational drug design targeting the PGP-binding cleft .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirements when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
pgpB; SF1282; S1365; Phosphatidylglycerophosphatase B; Diacylglycerol pyrophosphate phosphatase; DGPP phosphatase; Phosphatidate phosphatase; Undecaprenyl pyrophosphate phosphatase; Undecaprenyl-diphosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Shigella flexneri
Target Names
pgpB
Target Protein Sequence
MRSIARRTAVGAALLLVMPVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLIL FGWFLWCLRFRIKAAFVLFAILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDE FYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFPSGHTMFAASWALLAVGLLWP RRRTLTIAILLVWATGVMGSRLLLGMHWPRDLVVATLISWALVAVATWLAQRICGPLTPP AEENREIAQREQES
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and subsequently dephosphorylates PA to diacylglycerol (DAG). It also exhibits undecaprenyl pyrophosphate phosphatase activity, crucial for the biosynthesis of the lipid carrier undecaprenyl phosphate. Additionally, it can utilize lysophosphatidic acid (LPA) and phosphatidylglycerophosphate as substrates. The pattern of activities varies depending on the subcellular location. PGP phosphatase activity is higher in the cytoplasmic membrane, while PA and LPA phosphatase activities are more prevalent in the outer membrane. Activity is independent of divalent cation ions and insensitive to inhibition by N-ethylmaleimide.
Database Links

KEGG: sfl:SF1282

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Cell outer membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylglycerophosphatase B (pgpB) and what is its primary function?

Phosphatidylglycerophosphatase B (pgpB) is a membrane-integrated type II phosphatidic acid phosphatase (PAP2) family member primarily found in bacteria such as Escherichia coli. Its fundamental function involves catalyzing the removal of terminal phosphate groups from lipid carriers, particularly undecaprenyl pyrophosphate. This enzymatic activity is essential for the transport of various hydrophilic small molecules across the cell membrane . In organisms like cyanobacteria, pgpB plays a critical role in phosphatidylglycerol (PG) biosynthesis by catalyzing the dephosphorylation of phosphatidylglycerophosphate (PGP) .

How is the three-dimensional structure of PgpB characterized?

The three-dimensional structure of E. coli PgpB has been determined using X-ray crystallography at a resolution of 3.2 Å. Structural analyses reveal that PgpB shares similar folding topology and an almost identical active site with soluble PAP2 enzymes, despite having a unique substrate binding mechanism. The crystal structure shows that the potential substrate entrance to the active site is distinctively located in a cleft formed by a V-shaped transmembrane helix pair. This configuration allows lateral movement of lipid substrates entering the active site directly from the membrane lipid bilayer .

What cellular processes depend on proper PgpB function?

In photosynthetic organisms such as cyanobacteria, PgpB function is integrally linked to photosynthetic efficiency. Studies with PG-deficient mutants in Anabaena sp. PCC7120 (with disrupted pgpB gene) demonstrate that reduction in PG content significantly impairs photoautotrophic growth. These mutants exhibit decreased cellular chlorophyll content, reduced net photosynthetic activity, and diminished photosystem II (PSII) efficiency. The photochemical efficiency of PSII is considerably declined in these mutants, with less excitation energy transferred toward PSII .

How does the substrate binding mechanism of PgpB differ from soluble PAP2 enzymes?

While PgpB shares structural similarities with soluble PAP2 enzymes in terms of folding topology and active site composition, its substrate binding mechanism appears fundamentally different. In membrane-integrated PgpB, the substrate entrance forms in a cleft created by a V-shaped transmembrane helix pair. This unique structural feature facilitates lateral movement of lipid substrates directly from the membrane bilayer into the active site - a mechanism distinct from soluble PAP2 enzymes that interact with substrates from the aqueous environment .

How can rational mutagenesis be applied to modify PgpB activity while maintaining structural integrity?

Rational mutagenesis strategies for PgpB can be modeled after approaches used with related enzymes like CrPDAT. This involves creating a 3D structural model through homology modeling and identifying key functional domains through substrate docking simulations. For example, in similar phospholipid-modifying enzymes, researchers have identified distinct hydrophobic pockets that bind aliphatic chains of substrates. Based on in silico predictions, strategic mutations can be introduced to modify specific enzymatic activities (such as lipase activity) without disrupting the primary transferase function .

What expression systems yield optimal recombinant PgpB for structural studies?

For membrane proteins like PgpB, E. coli-based expression systems offer an effective platform when optimized properly. The ΔΔBL21 strain has proven effective for related membrane-associated enzymes. When expressing membrane phosphatases, considerations must include:

  • Codon optimization for the expression host

  • Induction conditions (temperature, IPTG concentration, and induction timing)

  • Membrane targeting sequences

  • Fusion tags that enhance solubility without compromising activity

Expression levels should be monitored not just by total protein yield but also by measuring specific enzymatic activity to ensure properly folded, functional protein .

What analytical methods effectively measure PgpB enzymatic activity?

PgpB activity can be measured through multiple complementary approaches:

  • Phosphate release assays: Quantifying released inorganic phosphate using colorimetric methods such as malachite green assay

  • Radiolabeled substrate assays: Using 32P-labeled phosphatidylglycerophosphate to track dephosphorylation

  • HPLC/MS analysis: Monitoring substrate depletion and product formation

  • In vivo complementation studies: Assessing the ability of PgpB variants to restore normal phenotypes in deficient strains

Activity measurements should include appropriate controls and consider variables such as detergent concentration, lipid environment, and buffer composition that may affect enzyme stability and function .

How can lipid composition changes be accurately quantified in PgpB mutant studies?

Accurate quantification of lipid composition changes in PgpB mutant studies requires comprehensive lipid profiling. In studies with cyanobacterial pgpB mutants, researchers extracted total cellular lipids and analyzed the composition of lipid classes using techniques such as thin-layer chromatography followed by quantification. The data presented in Table I demonstrates this approach:

Table I. Lipid Composition in Wild Type vs PgpB Mutant Cells

StrainConditionMGDGDGDGSQDGPG
Wild type+ PG37.019.817.026.2
Wild type- PG34.022.519.524.0
Mutant+ PG36.621.020.821.6
Mutant- PG31.923.628.516.0

Values represent mol% of total membrane lipids. Cells were grown with (+) or without (-) 6 μM exogenous PG for 10 days .

These analyses reveal that PgpB mutation results in approximately 30% reduction in cellular PG content with compensatory increases in other lipids, particularly SQDG.

How does PgpB deficiency affect membrane composition and photosynthetic activity?

PgpB deficiency significantly impacts both membrane composition and photosynthetic function. In cyanobacterial models, disruption of the pgpB gene (alr1715) results in:

  • Approximately 30% reduction in cellular phosphatidylglycerol (PG) content

  • Compensatory increase in sulfoquinovosyldiacylglycerol (SQDG) from 20% to 29% of total lipids

  • Restrained photoautotrophic growth

  • Decreased cellular chlorophyll content

  • Reduced net photosynthetic activity

  • Diminished photosystem II (PSII) efficiency

  • Decreased excitation energy transfer to PSII

These findings demonstrate the essential role of PgpB in maintaining optimal photosynthetic apparatus function through its involvement in PG biosynthesis .

How can PgpB serve as a structural model for eukaryotic PAP2 enzymes?

PgpB serves as an invaluable structural model for studying eukaryotic PAP2 enzymes, including the clinically significant human glucose-6-phosphatase. The 3D structure of E. coli PgpB provides critical insights into the catalytic mechanism shared across the PAP2 family. Despite differences in substrate specificity and membrane integration, the core catalytic machinery remains highly conserved. This conservation allows researchers to make informed predictions about structure-function relationships in eukaryotic homologs where direct structural determination may be challenging. Furthermore, the detailed understanding of how membrane-integrated PAP2 enzymes like PgpB recognize and process lipid substrates offers a framework for investigating similar processes in more complex eukaryotic systems .

What implications does PgpB research have for antibiotic development?

Research on PgpB has significant implications for antibiotic development, particularly for targeting cell envelope biogenesis. Since PgpB catalyzes essential steps in phospholipid metabolism and is involved in undecaprenyl pyrophosphate processing (critical for cell wall synthesis), it represents a potential target for novel antimicrobials. The availability of high-resolution structural data enables structure-based drug design approaches to develop specific inhibitors. Such inhibitors could disrupt membrane integrity and cell wall synthesis in bacteria while potentially avoiding mechanisms of resistance to current antibiotics. Additionally, the differences between bacterial PgpB and mammalian phosphatases could be exploited to develop selective antimicrobial agents with minimal host toxicity .

How might PgpB function be relevant to agricultural applications involving PGPB?

Although PgpB itself is not directly involved in plant growth promotion, understanding phosphate metabolism in bacteria has significant implications for agricultural applications involving plant growth-promoting bacteria (PGPB). Phosphate metabolism is central to PGPB function, as many of these beneficial bacteria enhance plant growth by solubilizing soil phosphorus and making it available to plants. The mechanisms of phosphate hydrolysis by phosphatases like PgpB share conceptual similarities with processes utilized by PGPB. Research on phosphatase enzymes contributes to our understanding of how bacteria modulate nutrient availability in the rhizosphere. This knowledge could inform the development of improved PGPB strains with enhanced phosphate solubilization capabilities for sustainable agriculture applications .

What are promising areas for advancing PgpB structure-function relationships?

Future research on PgpB structure-function relationships could profitably focus on several areas:

  • Higher-resolution structures of PgpB in complex with substrate analogs to elucidate precise binding interactions

  • Molecular dynamics simulations to understand protein flexibility and substrate approach pathways

  • Investigation of potential allosteric regulation sites on PgpB

  • Comparative structural biology of PgpB homologs across diverse bacterial species to understand evolutionary adaptations

  • Exploration of potential protein-protein interactions that might modulate PgpB activity in vivo

These approaches would build on existing structural data to develop a more comprehensive understanding of how PgpB functions within the cellular environment and how its activity is regulated .

How might advanced imaging techniques enhance our understanding of PgpB localization and dynamics?

Advanced imaging techniques offer promising avenues for understanding PgpB localization and dynamics within living cells. Approaches such as:

  • Super-resolution microscopy (STORM/PALM) with fluorescently tagged PgpB to visualize its distribution in bacterial membranes

  • Single-molecule tracking to monitor PgpB mobility within the membrane landscape

  • FRET-based sensors to detect conformational changes during catalysis

  • Cryo-electron tomography to visualize PgpB in its native membrane context

  • Correlative light and electron microscopy to connect PgpB distribution with ultrastructural features

These techniques could reveal how PgpB organization within membranes relates to its function, potentially uncovering specialized membrane domains or interactions with other components of phospholipid biosynthetic machinery that are not apparent from biochemical studies alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.