Recombinant Phosphatidylinositol mannoside acyltransferase (Rv2611c, MT2686)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Target Names
Rv2611c, MT2686
Target Protein Sequence
MIAGLKGLKLPKDPRSSVTRTATDWAYAAGWMAVRALPEFAVRNAFDTGARYFARHGGPE QLRKNLARVLGVPPAAVPDPLMCASLESYGRYWREVFRLPTINHRKLARQLDRVIGGLDH LDAALAAGLGAVLALPHSGNWDMAGMWLVQRHGTFTTVAERLKPESLYQRFIDYRESLGF EVLPLSGGERPPFEVLSERLRNNRVVCLMAERDLTRTGVEVDFFGEPTRMPVGPAKLAVE TGAALLPTHCWFEGRGWGFQVYPALDCTSGDVAAITQALADRFAQNIAAHPADWHMLQPQ WLADLSESRRAQLRSR
Uniprot No.

Q&A

What is the biochemical function of Rv2611c?

Rv2611c encodes a probable acyltransferase that catalyzes the acylation of the 6-position of the mannose residue linked to position 2 of the myo-inositol in phosphatidylinositol mono- and di-mannosides . This enzymatic activity is crucial for the proper assembly of the mycobacterial cell envelope, which serves as both a protective barrier and a platform for interactions with the host immune system . The enzyme belongs to the functional category of lipid metabolism and represents an essential component of the mycobacterial biosynthetic machinery .

What is the genetic organization and conservation of Rv2611c?

Rv2611c is located at genomic coordinates 2939012-2939962 on the negative strand of the M. tuberculosis H37Rv genome and encodes a protein of 316 amino acids . The gene shows high sequence conservation across mycobacterial species, with significant homology to proteins in related organisms:

SpeciesProtein IdentifierLength (aa)Identity (%)FASTA ScoreE-value
M. lepraeO07148/ML045332071.45%15295e-90
M. smegmatisQ9F7Y830372.15%14646.5e-86
S. coelicolorQ9L283/SCL2.16c31147.7%8102.8e-44
C. jejuniQ9F0N329520.45%2076.4e-06

This high degree of conservation, particularly within the Mycobacterium genus, suggests evolutionary importance of this enzyme's function .

Why is Rv2611c considered an essential gene?

Multiple independent studies have demonstrated that Rv2611c is essential for M. tuberculosis H37Rv viability using various transposon mutagenesis approaches . Essentiality has been confirmed by:

  • Himar1 transposon mutagenesis in H37Rv strain (Sassetti et al., 2003)

  • Analysis of saturated Himar1 transposon libraries (DeJesus et al., 2017)

  • Transposon mutagenesis in MtbYM rich medium (Minato et al., 2019)

  • Additional transposon mutagenesis studies (Griffin et al., 2011)

This consistent identification across multiple methodologies and research groups establishes Rv2611c as a critical gene for mycobacterial survival .

What expression systems have proven successful for Rv2611c?

While direct expression of Rv2611c from M. tuberculosis has historically been challenging, researchers have successfully expressed and purified MSMEG_2934, the ortholog of Rv2611c from the non-pathogenic model organism Mycobacterium smegmatis mc²155 . This was achieved using the mycobacterial pJAM2 expression system, which allowed confirmation of in vitro acyltransferase activity and establishment of substrate specificity .

For researchers attempting expression of Rv2611c itself, several approaches may be considered:

  • Homologous expression in mycobacterial systems (such as pJAM2)

  • Codon-optimized heterologous expression in E. coli

  • Expression with solubility-enhancing fusion partners

  • Cell-free expression systems for potentially difficult membrane-associated proteins

What purification challenges must be addressed for Rv2611c?

Purification of Rv2611c presents several technical challenges that have historically limited its biochemical characterization:

  • Membrane association properties affecting solubility

  • Requirement for appropriate detergents to maintain native structure and activity

  • Potentially low expression levels in heterologous systems

  • Maintaining enzymatic activity throughout purification processes

Until recently, these challenges prevented complete biochemical characterization despite the enzyme's function being annotated over a decade ago . The successful purification of the M. smegmatis ortholog represents a breakthrough in overcoming these obstacles.

What activity assay methods are appropriate for purified Rv2611c?

Following successful purification, researchers can verify and characterize the enzymatic activity of Rv2611c using several approaches:

Assay TypeMethodAdvantagesConsiderations
Radiometric[¹⁴C]-labeled acyl-CoA incorporationHigh sensitivityRequires radioisotope facilities
HPLC-MSDirect product detectionStructural confirmationSpecialized equipment needed
ColorimetricCoA release detection (DTNB)Simple implementationLower specificity
Coupled-enzymeNAD⁺/NADH conversionContinuous monitoringPotential interference

The ideal assay conditions would typically include purified enzyme (1-10 μg), appropriate substrates (phosphatidylinositol mannoside and acyl-CoA donor), buffer system (pH 7.0-8.0), and additives to maintain enzyme stability and activity .

What is known about the structural features of Rv2611c?

While a crystal structure of Rv2611c has not yet been reported in the literature, sequence analysis suggests the presence of characteristic domains and motifs found in bacterial acyltransferases:

  • Probable HxxxD catalytic motif common to acyltransferases

  • Hydrophobic regions consistent with membrane association

  • Putative substrate-binding domains for both acyl donor and phosphatidylinositol mannoside acceptor

Comparative analysis with other acyltransferases suggests that despite moderate sequence identity with enzymes from other bacterial species, the core catalytic domain is likely conserved while substrate-binding regions may show species-specific variations .

How does the catalytic mechanism of Rv2611c compare to other acyltransferases?

Based on studies with related acyltransferases, Rv2611c likely employs a ping-pong bi-bi reaction mechanism involving:

  • Binding of the acyl-CoA donor substrate

  • Formation of an acyl-enzyme intermediate

  • Release of CoA

  • Binding of the phosphatidylinositol mannoside acceptor substrate

  • Transfer of the acyl group to the specific 6-position of the mannose residue

  • Release of the acylated product

The highly specific position targeted by this enzyme (6-position of a particular mannose residue) highlights the precision of mycobacterial cell wall biosynthesis machinery .

What computational approaches can aid in understanding Rv2611c function?

In the absence of experimental structural data, computational approaches offer valuable insights:

  • Homology modeling based on structurally characterized acyltransferases

  • Molecular dynamics simulations to predict substrate binding and catalysis

  • Virtual screening for potential inhibitors targeting the active site

  • Sequence-based evolutionary analysis to identify conserved functional residues

These computational methods can guide experimental design and provide testable hypotheses about structure-function relationships in Rv2611c.

How does Rv2611c contribute to mycobacterial pathogenesis?

Rv2611c plays a crucial role in mycobacterial pathogenesis through multiple mechanisms:

  • Maintaining cell wall integrity by catalyzing the proper acylation of phosphatidylinositol mannosides

  • Contributing to the biosynthesis of immunomodulatory molecules like lipoarabinomannan (LAM) and lipomannan (LM)

  • Supporting bacterial survival within the host environment

  • Facilitating host-pathogen interactions during infection

The phosphatidylinositol mannosides modified by Rv2611c serve as essential structural components of the mycobacterial cell envelope and are implicated in host-pathogen interactions during infection .

Why is Rv2611c considered a potential drug target?

Several characteristics make Rv2611c an attractive target for tuberculosis drug development:

  • Essential nature for bacterial viability, as demonstrated by multiple transposon mutagenesis studies

  • No human homologs, reducing the risk of off-target effects

  • Defined enzymatic activity amenable to inhibitor design

  • Role in cell wall biosynthesis, a validated pathway for antimycobacterial drugs

The targeting of enzymes involved in mycobacterial cell wall biosynthesis has proven successful for existing TB drugs, and Rv2611c represents an unexploited target in this pathway .

How does Rv2611c interact with the host immune system?

While Rv2611c itself does not directly interact with host immune factors, the products of its enzymatic activity are immunologically significant:

  • Phosphatidylinositol mannosides serve as precursors for lipoarabinomannan (LAM) and lipomannan (LM), which modulate host immune responses

  • Properly acylated cell wall components affect mycobacterial recognition by pattern recognition receptors

  • The integrity of the mycobacterial cell envelope influences survival within macrophages

These immunomodulatory properties of Rv2611c-dependent cell wall components make it relevant to understanding mycobacterial evasion of host defenses .

What genetic manipulation strategies can be used to study Rv2611c?

Due to the essential nature of Rv2611c, conventional gene knockout approaches are not viable. Alternative genetic strategies include:

  • Conditional expression systems using tetracycline-regulated promoters

  • CRISPR interference (CRISPRi) for partial transcriptional repression

  • Domain-specific mutations to disrupt function without eliminating expression

  • Heterologous expression in M. smegmatis to study complementation

These approaches allow researchers to manipulate Rv2611c expression or function while avoiding lethal effects on bacterial viability.

How can structural information guide inhibitor development against Rv2611c?

Structure-based drug design approaches for Rv2611c would follow this general workflow:

  • Development of homology models based on related acyltransferases

  • Molecular docking of compound libraries to identify potential binding modes

  • Rational design of compounds targeting the catalytic site or substrate-binding regions

  • Medicinal chemistry optimization of lead compounds for improved potency and pharmacokinetic properties

The successful expression and purification of the M. smegmatis ortholog MSMEG_2934 provides a platform for structural studies that could accelerate inhibitor development .

What advanced biochemical techniques can characterize Rv2611c substrate specificity?

Several sophisticated approaches can define the substrate preferences of Rv2611c:

TechniqueApplicationInformation Gained
Saturation Transfer Difference NMRSubstrate binding analysisBinding epitope mapping
Enzyme kinetics with substrate analogsStructure-activity relationshipDeterminants of substrate recognition
Native mass spectrometryEnzyme-substrate complex detectionBinding stoichiometry and affinity
Site-directed mutagenesisActive site mappingCritical residues for catalysis

These approaches can provide detailed insights into how Rv2611c recognizes its substrates and catalyzes the acyl transfer reaction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.