Recombinant Phosphoethanolamine transferase CptA (cptA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Phosphoethanolamine transferase CptA (cptA) is a bacterial enzyme responsible for modifying lipopolysaccharide (LPS) by transferring phosphoethanolamine (pEtN) groups to specific sites on the LPS core. This modification enhances bacterial resistance to cationic antimicrobial peptides (CAMPs) and last-resort antibiotics like polymyxins . CptA is a member of the alkaline phosphatase superfamily of metalloenzymes and is regulated by the PmrA-PmrB two-component system in Salmonella enterica and other Gram-negative pathogens . Its activity is critical for maintaining outer membrane stability under stress conditions.

LPS Modification

CptA-mediated pEtN addition to the LPS core alters bacterial surface charge, reducing permeability to CAMPs and polymyxins. In Salmonella, this modification is upregulated under low Mg²⁺ or high Fe³⁺ conditions via PmrA-PmrB signaling .

Polymyxin Resistance

While CptA contributes modestly to polymyxin resistance, its role becomes pronounced in the absence of 4-amino-4-deoxy-L-arabinose (L-Ara4N) lipid A modifications. For example:

  • A cptA mutant in a PmrA-constitutive (pmrAᶜ) background showed a ~2-fold reduction in survival under polymyxin stress .

  • In a pmrAᶜ pmrF::Tn10 mutant (lacking L-Ara4N), cptA deletion reduced survival by 94-fold, highlighting its compensatory role .

Mutagenesis and Phenotypic Analysis

StrainLPS ModificationPolymyxin Survival (vs. Wild-Type)
Wild-Type (PmrAᶜ)Core pEtN + lipid A Ara4N100%
cptA mutant (PmrAᶜ)Loss of core pEtN~50% reduction
pmrC mutant (PmrAᶜ)Loss of lipid A pEtN~90% reduction
cptA pmrC mutantLoss of both core and lipid A pEtN~95% reduction

Data derived from LPS structural analysis and survival assays in Salmonella .

Key Observations

  • Genetic redundancy: cptA and pmrC operate independently, with PmrC dedicated to lipid A modification .

  • Regulatory interplay: cptA transcription is tightly coupled to pmrCAB operon expression under PmrA control .

Comparative Analysis with Related Enzymes

FeatureCptAPmrCEptA
SubstrateLPS core (heptose I)Lipid ALipid A or Kdo
RegulationPmrA-PmrBPmrA-PmrBColRS (Zn²⁺-dependent)
Role in ResistanceMinor (core-specific)Major (lipid A-specific)Critical (broad substrate range)
Catalytic MotifThr-His-AspSimilar metal-binding residuesGlu-Thr-His-Asp

Sources: .

Implications for Antimicrobial Resistance

CptA represents a potential target for adjuvant therapies aimed at restoring polymyxin efficacy. Key considerations include:

  • Inhibitor design: Targeting the conserved Thr-His-Asp motif or substrate-binding pockets could block pEtN transfer .

  • Synergistic strategies: Combining CptA inhibitors with polymyxins may overcome resistance in Salmonella and related pathogens .

  • Toxicity balance: Overexpression of PEtN transferases like CptA can disrupt membrane homeostasis, suggesting a vulnerability to exploit .

Future Directions

  • Structural studies: High-resolution crystallography of CptA-substrate complexes to guide inhibitor design.

  • In vivo validation: Testing CptA inhibitors in animal models of Salmonella infection.

  • Broad-spectrum potential: Investigating CptA homologs in multidrug-resistant Pseudomonas aeruginosa and Escherichia coli .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
eptC; cptA; yijP; Phosphoethanolamine transferase EptC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Escherichia coli
Target Names
eptC
Target Protein Sequence
MHSTEVQAKPLFSWKALGWALLYFWFFSTLLQAIIYISGYSGTNGIRDSLLFSSLWLIPV FLFPKRIKIIAAVIGVVLWAASLAALCYYVIYGQEFSQSVLFVMFETNTNEASEYLSQYF SLKIVLIALAYTAVAVLLWTRLRPVYIPKPWRYVVSFALLYGLILHPIAMNTFIKNKPFE KTLDNLASRMEPAAPWQFLTGYYQYRQQLNSLTKLLNENNALPPLANFKDESGNEPRTLV LVIGESTQRGRMSLYGYPRETTPELDALHKTDPNLTVFNNVVTSRPYTIEILQQALTFAN EKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTMTARNTMLTVFSRQTDKQYYMNQQRTQS AREYDTNVLKPFQEVLKDPAPKKLIIVHLLGTHIKYKYRYPEDQGKFDGNTEHVPPGLNA EELESYNDYDNANLYNDHVVASLIKDFKATDPNGFLVYFSDHGEEVYDTPPHKTQGRNED NPTRHMYTIPFLLWTSEKWQATHPRDFSQDVDRKYSLAELIHTWSDLAGLSYDGYDPTRS VVNPQFKETTRWIGNPYKKNALIDYDTLPYGDQVGNQ
Uniprot No.

Target Background

Function

Recombinant Phosphoethanolamine transferase CptA (cptA) catalyzes the addition of a phosphoethanolamine moiety to the outer membrane lipopolysaccharide core. It plays a crucial role in the pathogenesis of *E. coli* meningitis and is essential for *E. coli* K1 invasion of brain microvascular endothelial cells (BMECs). CptA contributes to *E. coli*'s ability to traverse the blood-brain barrier.

Protein Families
Phosphoethanolamine transferase family, EptC/CptA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoethanolamine Transferase CptA and what is its function?

Phosphoethanolamine transferase CptA belongs to a family of enzymes that catalyzes the transfer of phosphoethanolamine (PEtN) groups from phosphatidylethanolamine (PE) to the lipid A component of bacterial lipopolysaccharide (LPS) . The primary function of this enzyme involves the modification of lipid A through the addition of PEtN groups, which results in changes to the bacterial outer membrane structure . This modification plays a significant role in bacterial resistance to cationic antimicrobial peptides (CAMPs) and last-resort antibiotics like colistin .

The catalytic mechanism involves a PEtN-enzyme intermediate, where the enzyme transfers the PEtN group to specific positions (typically the 1 and 4' headgroups) of lipid A . This enzymatic activity requires a zinc ion (Zn²⁺) that is tetrahedrally coordinated by conserved amino acid residues in the enzyme's active site, including a catalytic threonine nucleophile essential for PEtN transfer . The enzyme structure typically consists of both membrane and soluble periplasmic domains that work together to enable substrate binding and catalysis .

How does CptA differ from other phosphoethanolamine transferases like EptA and MCR-1?

While CptA shares functional similarities with other phosphoethanolamine transferases such as EptA and MCR-1, there are several notable differences in their expression patterns, structural features, and impacts on bacterial fitness:

  • Origin and expression: EptA is typically an endogenous transferase naturally present in bacteria like P. aeruginosa, while MCR-1 is considered an exogenous transferase that can be acquired through horizontal gene transfer . CptA's specific expression patterns may differ from these established transferases.

  • Structural differences: All these transferases contain a hydrolase fold similar to phosphonate monoester hydrolase and arylsulfatase, but they may differ in specific structural elements . For example, EptA contains five transmembrane helices with only one (TMH5) spanning the full membrane width, and it has specific disulfide bonds that contribute to its stability .

  • Effect on bacterial fitness: Research has shown that EptA overexpression in P. aeruginosa negatively affects bacterial growth and cell envelope integrity, while MCR-1 expression has minimal impact on fitness . These differences suggest that various PEtN transferases may impose different metabolic burdens on their bacterial hosts.

  • Substrate specificity: While all these enzymes modify lipid A with PEtN groups, they may have different preferences for specific positions on the lipid A molecule or different efficiencies in catalyzing the transfer reaction .

What experimental methods are used to study CptA expression and activity?

Several complementary methods are employed to study the expression and activity of phosphoethanolamine transferases like CptA:

  • Recombinant protein expression systems: Researchers commonly use IPTG-inducible plasmid constructs to express recombinant forms of these enzymes in bacterial hosts . This approach allows for controlled expression levels by varying IPTG concentration.

  • Mass spectrometry analysis: Matrix-Assisted Laser Desorption/Ionization Time-of-Flight (MALDI-TOF) mass spectrometry is used to analyze lipid A modifications . The addition of a PEtN group results in a characteristic +123 shift in the m/z value of lipid A peaks, allowing researchers to confirm enzymatic activity .

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can be measured to assess protein conformation and stability under different conditions . Changes in emission maxima and quenching experiments provide insights into structural aspects of the enzyme.

  • Minimum Inhibitory Concentration (MIC) assays: These assays determine the impact of enzyme expression on bacterial resistance to colistin and other antimicrobial agents . By comparing MIC values between strains with and without enzyme expression, researchers can quantify the contribution of the enzyme to antimicrobial resistance.

  • Enzyme activity assays: In vitro assays using purified enzyme and lipid substrates can be performed to directly measure PEtN transfer activity . These assays may involve detergent-solubilized enzyme preparations and can provide insights into kinetic parameters and substrate specificity.

How do structural elements of CptA influence its catalytic function?

The structure-function relationship in phosphoethanolamine transferases like CptA is complex and involves several key elements that are critical for catalytic activity:

  • Domain architecture: These enzymes typically have a membrane domain containing transmembrane helices and a soluble periplasmic domain with the catalytic site . The membrane domain is essential for recognizing and binding lipid substrates, while the soluble domain contains the active site for catalysis. Studies with truncated forms lacking the membrane domain have shown that the full-length enzyme is required for activity on lipid substrates .

  • Active site configuration: The active site contains a zinc ion (Zn²⁺) that is tetrahedrally coordinated by conserved residues (such as His453, Asp452, Glu240, and Thr280 in NmEptA) . The threonine residue serves as the catalytic nucleophile and exists as a phosphothreonine in some crystal structures, indicating its role in forming a PEtN-enzyme intermediate during catalysis .

  • Disulfide bonds: Specific disulfide bonds in the soluble domain contribute to structural stability . For example, three disulfide bonds (Cys276-286, Cys327-Cys331, and Cys402-Cys410 in NmEptA) are structurally conserved among various PEtN transferases acting on lipid A .

  • Membrane-soluble domain interface: The interface between the membrane and soluble domains is extensive (approximately 1,200 Ų in NmEptA) and likely plays a role in coordinating substrate recognition and catalysis . This interface may facilitate conformational changes needed to accommodate the two very differently sized substrates (PE and lipid A).

  • Aromatic belt: An arrangement of tryptophan, tyrosine, and histidine residues forms an aromatic belt along the membrane surface, which helps stabilize and orient the protein within the lipid bilayer . This proper orientation is crucial for accessing both substrates.

Mutagenesis experiments targeting specific structural elements can provide valuable insights into their roles in enzyme function. For example, substitution of the catalytic threonine with alanine significantly decreases resistance to colistin and polymyxin B, confirming its essential role in catalysis .

What are the optimal conditions for expressing and purifying recombinant CptA?

The expression and purification of recombinant phosphoethanolamine transferases require careful optimization due to their membrane-associated nature. Based on the available research, the following conditions have been found effective:

  • Expression system: IPTG-inducible plasmid constructs in appropriate bacterial hosts (such as P. aeruginosa strains PAO1 or PA14 for studying PEtN transferases in this species) . The concentration of IPTG can be adjusted to control expression levels, with typical concentrations around 0.5 mM .

  • Detergent selection: The choice of detergent for membrane protein solubilization significantly impacts enzyme structure and activity . Dodecyl-β-D-maltoside (DDM) and Cymal-6 have been shown to maintain enzyme function better than Fos-Choline-12 (FC-12) . This is evidenced by differences in tryptophan fluorescence emission spectra and Stern-Volmer quenching constants between enzymes purified in different detergents .

  • Buffer composition: Typical buffers include:

    • For extraction: 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, with appropriate protease inhibitors

    • For purification: 50 mM HEPES (pH 7.5), 300 mM NaCl, 0.05% DDM

    • For activity assays: 50 mM HEPES (pH 7.5), 150 mM NaCl, 0.05% DDM

  • Purification strategy: A multi-step purification approach typically includes:

    • Affinity chromatography (often using His-tagged constructs)

    • Size exclusion chromatography to remove aggregates and obtain homogenous preparations

    • Quality control by SDS-PAGE and Western blotting

  • Enzyme stability assessment: Circular dichroism (CD) spectroscopy and fluorescence spectroscopy can be used to assess the structural integrity and stability of the purified enzyme under different conditions . These techniques help ensure that the purified enzyme retains its native fold and activity.

The functional integrity of the purified enzyme should be confirmed through activity assays, such as lipid A modification assays monitored by mass spectrometry .

How can optimal experimental design improve parameter estimates in CptA enzymatic models?

Optimal experimental design (OED) represents a sophisticated approach to enhance parameter estimates in enzymatic models of phosphoethanolamine transferases like CptA. This approach is particularly valuable for complex biochemical systems with multiple uncertain parameters .

The Bayesian optimal experimental design methodology involves several key steps:

  • Parameter sensitivity analysis: Identifying the most significant parameters that affect model outcomes through global sensitivity analysis . For CptA enzymatic models, these might include binding affinities, catalytic rates, and substrate specificity parameters.

  • Prior parameter distribution: Establishing prior distributions for uncertain parameters based on existing knowledge or expert opinion . For CptA, this might incorporate knowledge about related enzymes like EptA or MCR-1.

  • Experimental design selection: Evaluating potential experimental designs (such as which species to measure) to determine which would provide the most information about uncertain parameters . For CptA studies, this might involve choosing between measuring substrate consumption, product formation, or intermediate enzyme states.

  • Decision-relevant metrics: Developing metrics that quantify uncertainty in therapeutic performance, such as the probability of bacterial growth inhibition at a given inhibitor concentration (IC₅₀) . These metrics help focus experimental efforts on parameters most relevant to the research goals.

  • Computational implementation: Using high-performance computing to simulate experimental outcomes for different parameter sets and evaluate the information gain from each potential experiment . This approach has been successfully applied to systems with up to 23 equations and 11 uncertain parameters .

The benefits of this approach include more efficient use of resources, improved parameter identifiability, and ultimately more reliable models for predicting CptA function and inhibition. By systematically choosing experiments that maximize information gain, researchers can develop more accurate models with fewer experiments.

What role does CptA play in antimicrobial resistance, and how can this be quantified?

Phosphoethanolamine transferases like CptA play a significant role in antimicrobial resistance through several mechanisms that can be quantified using specific methodologies:

  • Modification of lipid A structure: CptA catalyzes the addition of PEtN groups to lipid A, which reduces the net negative charge of the bacterial outer membrane and decreases the binding affinity of cationic antimicrobial peptides and antibiotics like colistin . This modification directly contributes to resistance against these agents.

  • Quantification of resistance levels: Minimum Inhibitory Concentration (MIC) assays provide a standardized method to quantify resistance levels . Research with other PEtN transferases shows that their expression can increase colistin MIC values from susceptible levels (0.5-1 μg/mL) to resistant levels (4-16 μg/mL) . The relationship between enzyme expression levels and MIC values can be established by using inducible expression systems with varying inducer concentrations .

  • Impact on bacterial fitness: The expression of phosphoethanolamine transferases may affect bacterial growth and fitness . Growth curves, competitive growth assays, and cell envelope integrity tests can quantify these effects. Interestingly, different transferases may impose different fitness costs - for example, EptA negatively affects P. aeruginosa growth when highly expressed, while MCR-1 has minimal impact on fitness .

  • Structural determinants of resistance: Specific structural elements of these enzymes contribute differently to resistance versus fitness costs . Mutagenesis experiments targeting specific domains or residues can help determine which structural features are essential for resistance versus those responsible for any associated fitness costs .

  • Evolutionary considerations: The absence of significant fitness costs associated with some transferases (like MCR-1) suggests that there may be few barriers to their spread in bacterial populations . This has important implications for the epidemiology of resistance and potential treatment strategies.

By comprehensively quantifying these aspects, researchers can better understand the role of CptA in antimicrobial resistance and develop strategies to counter it, such as enzyme inhibitors that could restore antimicrobial susceptibility.

How does lipid A phosphoethanolamination affect bacterial immune evasion mechanisms?

The modification of lipid A with phosphoethanolamine groups has profound effects on bacterial interactions with host immune systems:

  • Altered recognition by immune receptors: Lipid A is a potent activator of innate immunity through recognition by Toll-like receptor 4 (TLR4) . PEtN modification can alter this recognition, potentially allowing bacteria to evade immune detection or modulate the inflammatory response.

  • Enhanced resistance to antimicrobial peptides: Host-derived antimicrobial peptides represent an important component of innate immunity . By reducing the negative charge of the bacterial outer membrane, PEtN modification decreases the binding affinity of cationic antimicrobial peptides, allowing bacteria to resist this arm of host defense .

  • Altered cytokine response: Research has shown that PEtN-modified lipid A can elicit different cytokine responses compared to unmodified lipid A . For example, the addition of PEtN to N. flavescens lipid A resulted in an increased cytokine response from THP-1 cells . This altered inflammatory profile may contribute to bacterial persistence or pathogenesis.

  • Impact on membrane permeability: Beyond specific antimicrobial resistance, PEtN modification affects general membrane properties, potentially influencing the permeability to various host-derived antimicrobial compounds .

  • Interaction with complement system: Modified lipid A may also affect the interaction with complement components, potentially altering opsonization and complement-mediated killing.

These immune evasion mechanisms can be quantified through various experimental approaches:

  • Cytokine production assays using cell lines like THP-1 macrophages

  • Antimicrobial peptide binding and killing assays

  • Serum resistance assays

  • In vivo infection models comparing wild-type bacteria with those expressing CptA or other PEtN transferases

Understanding these immune evasion mechanisms is crucial for developing therapeutic strategies that might restore immune clearance of resistant bacteria, potentially complementing direct antimicrobial approaches.

What are the key considerations for designing inhibitors targeting CptA?

Designing effective inhibitors for phosphoethanolamine transferases like CptA requires a multi-faceted approach that considers several key aspects:

  • Active site targeting: The catalytic site contains a zinc ion coordinated by conserved residues, making it an attractive target for inhibitor design . Metal-chelating compounds or molecules that displace the catalytic threonine residue could potentially inhibit enzyme function.

  • Substrate analog approach: Designing compounds that mimic either phosphatidylethanolamine or lipid A substrates could create competitive inhibitors. These analogs would need to:

    • Bind with higher affinity than natural substrates

    • Resist catalytic modification

    • Maintain sufficient solubility and membrane permeability

  • Interdomain interface disruption: The extensive interface between membrane and soluble domains (approximately 1,200 Ų) is critical for enzyme function . Compounds that disrupt this interface could prevent the conformational changes needed for catalysis.

  • Allosteric inhibition: Identifying allosteric sites that, when bound by small molecules, prevent the enzyme from adopting its catalytically active conformation.

  • Specificity considerations: Designed inhibitors should be specific for bacterial PEtN transferases without affecting mammalian enzymes with similar activities to avoid toxicity.

  • Delivery strategies: Since these enzymes have both periplasmic and membrane domains, inhibitors must cross the outer membrane of Gram-negative bacteria to reach their target. This requires consideration of compound size, charge, and lipophilicity.

  • Resistance development: The potential for bacteria to develop resistance to CptA inhibitors should be evaluated, particularly through mutations in the enzyme that might prevent inhibitor binding while maintaining catalytic activity.

The development pipeline would typically include:

  • Virtual screening based on crystal structures

  • Biochemical assays with purified enzyme

  • Cellular assays to confirm activity in bacterial cells

  • Structural studies of enzyme-inhibitor complexes to guide optimization

  • Assessment of toxicity and pharmacokinetic properties

By targeting CptA and other phosphoethanolamine transferases, such inhibitors could potentially restore susceptibility to colistin and other antimicrobial peptides, providing a valuable adjunctive therapy for infections caused by multidrug-resistant Gram-negative bacteria .

How can recombinant CptA be used as a tool in structural biology studies?

Recombinant phosphoethanolamine transferases like CptA offer valuable opportunities as tools in structural biology, providing insights into membrane protein structure, catalytic mechanisms, and conformational dynamics:

  • Crystallographic studies: Purified recombinant enzyme can be used for crystallization trials to determine high-resolution structures . These structures reveal important features such as the arrangement of transmembrane helices, the coordination of the zinc ion in the active site, and the extensive interface between membrane and soluble domains .

  • Membrane protein folding and stability: As membrane proteins with both transmembrane and soluble domains, these enzymes serve as excellent models for studying membrane protein folding, stability, and the impact of different detergents on protein structure . Biophysical techniques such as circular dichroism spectroscopy and fluorescence spectroscopy can reveal how different conditions affect protein conformation .

  • Structure-function relationships: By creating site-directed mutants of specific residues (such as the catalytic threonine or zinc-coordinating residues), researchers can correlate structural features with functional outcomes . Activity assays with these mutants provide insights into the catalytic mechanism.

  • Conformational dynamics: These enzymes likely undergo significant conformational changes to accommodate their two very differently sized substrates . Techniques such as hydrogen-deuterium exchange mass spectrometry, single-molecule FRET, or molecular dynamics simulations can reveal these dynamics.

  • Membrane domain organization: The unusual arrangement of transmembrane helices, with only one helix spanning the full membrane width, provides an interesting model for studying non-canonical membrane protein structures .

  • Protein-lipid interactions: The aromatic belt of tryptophan, tyrosine, and histidine residues along the membrane surface offers opportunities to study how proteins interact with and are positioned within lipid bilayers .

Key methodological approaches for these studies include:

  • Expression optimization in different bacterial hosts

  • Detergent screening for optimal protein extraction and stability

  • Purification strategy development

  • Biophysical characterization using spectroscopic methods

  • Activity assays to correlate structure with function

  • Computational modeling and simulation

These structural biology studies not only advance our understanding of phosphoethanolamine transferases but also contribute more broadly to membrane protein biochemistry and biophysics.

What analytical techniques are used to verify the enzymatic activity of CptA?

Multiple analytical techniques can be employed to verify and characterize the enzymatic activity of phosphoethanolamine transferases like CptA, each offering distinct insights into different aspects of enzyme function:

  • Mass spectrometry-based lipid analysis:

    • MALDI-TOF mass spectrometry provides direct evidence of PEtN addition to lipid A, characterized by a +123 m/z shift in modified lipid species

    • Liquid chromatography-mass spectrometry (LC-MS) can offer quantitative analysis of modified versus unmodified lipid species

    • Tandem mass spectrometry (MS/MS) can pinpoint the exact position of PEtN modification on the lipid A structure

  • Enzymatic activity assays:

    • Colorimetric assays measuring phosphate release during the transfer reaction

    • Fluorescently labeled substrate analogs that change properties upon modification

    • Coupled enzyme assays that link PEtN transfer to a detectable signal

  • Antimicrobial susceptibility testing:

    • Minimum Inhibitory Concentration (MIC) assays with colistin or other cationic antimicrobial peptides provide functional evidence of enzyme activity in bacterial cells

    • Time-kill assays can assess the dynamics of antimicrobial resistance conferred by the enzyme

  • Biophysical interaction studies:

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to measure binding kinetics of substrates

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of substrate binding

  • Structural verification:

    • X-ray crystallography or cryo-electron microscopy to capture enzyme states during catalysis

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes associated with substrate binding and catalysis

  • Radiolabeling experiments:

    • Using ³²P-labeled substrates to track phosphate transfer

    • Scintillation proximity assays for high-throughput activity screening

A comprehensive analytical approach would typically combine multiple techniques - for example, confirming enzyme activity through mass spectrometry analysis of modified lipid A, correlating this with increased colistin resistance in MIC assays, and verifying structural changes through biophysical methods .

How can contradictory experimental results in CptA research be reconciled?

Contradictory experimental results in research involving phosphoethanolamine transferases like CptA can arise from various sources and require systematic approaches to reconcile:

  • Experimental context differences:

    • Expression levels: Different levels of enzyme expression (controlled by varying IPTG concentrations in inducible systems) can lead to divergent phenotypes

    • Bacterial strain variations: Different genetic backgrounds may influence enzyme activity and phenotypic outcomes

    • Growth conditions: Media composition, growth phase, and environmental stressors can affect enzyme activity and resulting phenotypes

  • Methodological reconciliation approaches:

    • Standardization of experimental protocols across laboratories

    • Direct side-by-side comparisons under identical conditions

    • Meta-analysis of multiple studies to identify consistent patterns

    • Bayesian experimental design to systematically address uncertainties

  • Multi-level analysis strategy:

    • Molecular level: Verify enzyme activity through direct biochemical assays and mass spectrometry analysis of lipid modifications

    • Cellular level: Assess impacts on bacterial physiology, membrane integrity, and growth characteristics

    • Population level: Evaluate antimicrobial resistance profiles and competitive fitness

  • Addressing specific contradictions:

    • Fitness costs: If contradictory results exist regarding fitness costs of enzyme expression, experiments should control for expression levels, growth conditions, and use multiple fitness measures (growth rates, competition assays, etc.)

    • Structural requirements: If different studies identify different structural elements as essential, systematic mutagenesis studies coupled with both activity assays and structural analysis can help reconcile findings

    • Resistance levels: Standardized antimicrobial susceptibility testing methods should be employed to resolve contradictions in reported resistance levels

  • Computational approaches:

    • Mathematical modeling to identify parameter ranges that explain seemingly contradictory results

    • Simulation studies to explore how different experimental conditions might lead to divergent outcomes

    • Sensitivity analysis to identify which parameters most strongly influence experimental results

  • Technical considerations:

    • Enzyme purification in different detergents can lead to different conformational states and activities

    • Assay sensitivity and specificity issues may lead to false positive or negative results

    • Post-translational modifications or proteolytic processing might differ between experimental systems

By systematically addressing these factors, researchers can reconcile contradictory results and develop a more coherent understanding of phosphoethanolamine transferase function and biology.

How can CptA be utilized in developing novel antimicrobial strategies?

Phosphoethanolamine transferases like CptA offer several promising avenues for developing novel antimicrobial strategies:

  • Enzyme inhibitors as antibiotic adjuvants:

    • Small molecule inhibitors targeting the enzyme's active site or allosteric sites could restore bacterial susceptibility to colistin and other antimicrobial peptides

    • Such inhibitors would function as antibiotic adjuvants rather than direct antimicrobials, potentially extending the useful life of last-resort antibiotics

    • Structure-based drug design using the solved crystal structures of phosphoethanolamine transferases provides a rational approach to inhibitor development

  • Antivirulence strategy:

    • Rather than killing bacteria directly, targeting CptA represents an antivirulence approach that could reduce bacterial pathogenicity and increase susceptibility to host immune defenses

    • This approach may impose less selective pressure than conventional antibiotics, potentially slowing resistance development

  • Diagnostic applications:

    • Detection of CptA expression or activity could serve as a marker for predicting colistin resistance

    • Understanding the relationship between enzyme expression levels and resistance can help in developing quantitative diagnostic tools

  • Combination therapy optimization:

    • Knowledge of how CptA affects susceptibility to different antimicrobial agents can guide the design of optimized combination therapies

    • Bayesian experimental design approaches can help identify the most effective combinations and dosing strategies

  • Substrate competition strategy:

    • Developing non-toxic substrate analogs that compete with natural substrates but cannot be enzymatically modified

    • These competitive inhibitors could potentially reduce the efficiency of the resistance mechanism

  • Immunomodulatory applications:

    • Since PEtN-modified lipid A elicits different cytokine responses, understanding and manipulating this process could lead to novel immunomodulatory strategies

    • Vaccines targeting CptA or modified lipid A structures could potentially help prevent or treat infections by resistant bacteria

  • Bacterial fitness considerations:

    • If CptA expression imposes fitness costs similar to EptA in certain contexts, exploiting these fitness trade-offs could lead to novel treatment strategies that leverage evolutionary pressures

These strategies represent complementary approaches that could be developed simultaneously, potentially leading to multi-faceted antimicrobial interventions targeting phosphoethanolamine transferase-mediated resistance.

What are the critical factors in experimental design for studying CptA regulation?

Designing robust experiments to study the regulation of phosphoethanolamine transferases like CptA requires careful consideration of multiple factors:

  • Expression control systems:

    • Inducible promoter systems with titratable control (such as IPTG-inducible systems) allow precise manipulation of enzyme expression levels

    • Concentration-response experiments relating inducer levels to enzyme expression and resulting phenotypes provide valuable insights into regulatory thresholds

    • Native promoter constructs can reveal physiological regulation patterns

  • Environmental conditions affecting regulation:

    • pH variations: Testing enzyme expression and activity across physiologically relevant pH ranges

    • Nutrient availability: Examining how phosphate or ethanolamine availability influences expression

    • Antimicrobial stress: Measuring how sub-inhibitory concentrations of antimicrobials affect regulation

    • Growth phase effects: Monitoring expression patterns throughout bacterial growth phases

  • Genetic framework considerations:

    • Strain background selection is critical as different bacterial strains may have distinct regulatory networks

    • Construction of reporter systems (such as transcriptional or translational fusions) to monitor expression

    • Genetic manipulation of potential regulatory elements to establish causal relationships

  • Multi-level regulatory analysis:

    • Transcriptional regulation: qRT-PCR, RNA-seq, or reporter assays to measure mRNA levels

    • Post-transcriptional regulation: RNA stability assays, ribosome profiling

    • Post-translational regulation: Protein stability assays, activity measurements under different conditions

    • Epigenetic regulation: DNA methylation analysis, chromatin immunoprecipitation

  • Bayesian optimal experimental design:

    • Applying mathematical modeling to identify which experimental measurements would provide the most information about regulatory mechanisms

    • Prioritizing experiments based on their expected information gain rather than traditional factorial designs

    • Developing decision-relevant metrics specific to the regulatory aspects under investigation

  • Technical controls and validations:

    • Parallel analysis of known regulated genes/proteins as positive controls

    • Multiple methodologies to confirm key findings (e.g., complementing RNA-seq with proteomics)

    • Time-course experiments to capture dynamic regulatory responses

    • Dose-response studies to identify regulatory thresholds

  • Functional consequence assessment:

    • Linking regulatory changes to functional outcomes such as antimicrobial resistance

    • Measuring fitness impacts of different regulatory states

    • Assessing membrane modifications through lipidomic approaches

By systematically addressing these factors, researchers can develop a comprehensive understanding of the regulatory mechanisms controlling CptA expression and activity in various environmental and genetic contexts.

What are the current research gaps in CptA knowledge and future research directions?

Despite significant advances in understanding phosphoethanolamine transferases, several important knowledge gaps remain in CptA research that represent promising directions for future investigation:

  • Structural dynamics during catalysis:

    • While static crystal structures have been determined for related enzymes , the conformational changes that occur during the catalytic cycle remain poorly understood

    • Future research using techniques like hydrogen-deuterium exchange mass spectrometry, single-molecule FRET, and time-resolved structural studies could reveal these dynamic aspects

  • Substrate recognition specificity:

    • The molecular basis for substrate specificity among different phosphoethanolamine transferases remains incompletely characterized

    • Comparative studies between CptA and other family members (EptA, MCR-1) could identify key determinants of specificity

  • Regulatory networks:

    • The environmental and genetic factors that regulate CptA expression in different bacterial species need further elucidation

    • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics could help map these regulatory networks

  • Evolution and horizontal gene transfer:

    • Understanding the evolutionary history and transfer dynamics of these resistance determinants would provide insights into their spread

    • Population genomics studies tracking these genes across bacterial populations could reveal transmission patterns

  • Host-pathogen interactions:

    • The impact of lipid A phosphoethanolamination on host immune responses beyond antimicrobial peptide resistance requires further investigation

    • Studies using animal infection models and human cell systems could characterize these immunomodulatory effects

  • Inhibitor development challenges:

    • While enzymatic inhibitors represent a promising strategy, no effective inhibitors have yet reached clinical development

    • Structure-based drug design, high-throughput screening approaches, and medicinal chemistry optimization remain important future directions

  • Combined resistance mechanisms:

    • How CptA-mediated resistance interacts with other resistance mechanisms (efflux pumps, other lipid A modifications) remains poorly understood

    • Studies examining these interactions could reveal synergistic or antagonistic relationships between resistance mechanisms

  • Bayesian optimization of research:

    • Applying Bayesian optimal experimental design to prioritize which aspects of CptA biology should be investigated to maximize scientific progress

    • Developing computational models that can integrate diverse data types to predict enzyme behavior in different contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.