Recombinant Salmonella typhi Phosphoglycerate transport regulatory protein pgtC (pgtC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella typhi Phosphoglycerate Transport Regulatory Protein pgtC

The Recombinant Salmonella typhi Phosphoglycerate transport regulatory protein pgtC is a crucial component of the phosphoglycerate transport system in Salmonella typhi. This system is essential for the regulation of phosphoglycerate uptake, which is vital for bacterial metabolism and survival. The pgtC protein is part of an atypical two-component regulatory system that includes pgtA, pgtB, and pgtC, which together control the expression of the phosphoglycerate transporter pgtP .

Structure and Function of pgtC

The recombinant pgtC protein is a full-length mature protein consisting of amino acids 25-397. It is expressed in E. coli and fused with an N-terminal His tag for easy purification and identification . The pgtC protein plays a significant role in activating and modulating the kinase activity of pgtB, which is essential for the induction of pgtP expression .

Role in Phosphoglycerate Transport System

The phosphoglycerate transport system in Salmonella typhimurium consists of four genes: pgtABCP. The pgtP gene encodes the transporter itself, while pgtABC genes encode regulatory proteins necessary for controlling pgtP expression . The pgtC protein is crucial for the induction of pgtP expression by interacting with pgtB, which suggests that pgtC functions to activate and modulate the kinase activity of pgtB .

Research Findings and Implications

Studies on Salmonella typhimurium have shown that mutations in pgtB can lead to constitutive expression of pgtP independent of pgtC, indicating that pgtB can be activated in the absence of pgtC through specific mutations . This highlights the complex interaction between pgtB and pgtC in the signaling process.

Moreover, the phosphoglycerate transport protein pgtP itself functions as an anion exchange protein, facilitating the exchange of phosphate and phosphoglycerate across the membrane . This process is electroneutral and does not require a membrane potential, demonstrating its efficiency in maintaining cellular homeostasis.

References Niu, S., Jiang, S. Q., & Hong, J. (1995). Salmonella typhimurium pgtB mutants conferring constitutive expression of phosphoglycerate transporter pgtP independent of pgtC. Journal of Bacteriology, 177(15), 4297–4302. Kidwai, A. S., et al. (2013). The anti-virulence protein CigR creates a threshold for a virulence program directed by the MgtC protein in Salmonella. The EMBO Journal, 32(11), 1524–1535. Reconstitution of the phosphoglycerate transport protein of Salmonella typhimurium. (1990). PubMed. Recombinant Full Length Salmonella typhi Phosphoglycerate transport regulatory protein pgtC (pgtC) Protein. (2025). Creative Biomart. Salmonella typhimurium pgtB mutants conferring constitutive expression of phosphoglycerate transporter pgtP independent of pgtC. (2001). PMC.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
pgtC; STY2635; t0460; Phosphoglycerate transport regulatory protein PgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-397
Protein Length
Full Length of Mature Protein
Species
Salmonella typhi
Target Names
pgtC
Target Protein Sequence
WIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALL DSAPAASQKLVPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALL MSSPSRSDTNHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGP VIDNYANLLLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILAD ANTGKYPVAPLSADNPRAAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDA WRALHSAETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLN NQRLAIHKLEELK
Uniprot No.

Target Background

Function
Essential for pgtP expression; it may function in conjunction with the PgtA/PgtB signaling proteins.
Database Links

KEGG: stt:t0460

STRING: 220341.STY2635

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of PgtC in the phosphoglycerate transport system of Salmonella?

PgtC functions as a membrane-localized sensor component in the atypical "two-component" regulatory system that controls expression of the phosphoglycerate transporter PgtP. In this regulatory network, PgtC works alongside PgtB (a membrane-associated kinase/phosphatase) and PgtA (a cytoplasmic response regulator) to control the transport of 3-phosphoglycerate (3PG) .

PgtC specifically functions to activate and modulate the kinase activity of PgtB, which then influences PgtA-mediated transcriptional regulation. Experimental evidence indicates that PgtC and PgtB interact in the signaling process, with PgtC likely responding to environmental cues related to 3PG availability .

How does the PgtABC regulatory system differ from typical two-component systems?

While typical bacterial two-component systems consist of a sensor histidine kinase and a response regulator, the PgtABC system incorporates an additional component (PgtC) that modulates the activity of the kinase (PgtB). Research demonstrates that:

  • PgtC functions as a membrane-localized sensor that interacts with PgtB

  • PgtB serves as the histidine kinase/phosphatase with potential autophosphorylation at His-457

  • PgtA acts as the response regulator that controls transcription of the phosphoglycerate transporter gene pgtP

This tripartite arrangement allows for more nuanced regulation of phosphoglycerate transport, potentially enabling Salmonella to fine-tune its metabolic responses in different host environments.

What are the optimal conditions for recombinant expression of PgtC?

For successful recombinant expression of PgtC:

Experimental Protocol:

  • Clone the pgtC gene into an expression vector with an appropriate tag (e.g., His-tag) for purification

  • Transform the construct into a suitable E. coli expression strain (BL21(DE3) or derivatives)

  • Culture cells at 37°C in LB media supplemented with appropriate antibiotics until OD₆₀₀ reaches 0.6-0.8

  • Induce protein expression with 0.5-1 mM IPTG

  • Reduce temperature to 16-18°C and continue expression for 12-16 hours to maximize membrane protein folding

  • Harvest cells by centrifugation at 5000×g for 15 minutes

Key Considerations:

  • As PgtC is a membrane protein, expression conditions must be optimized to prevent formation of inclusion bodies

  • Addition of glycerol (5-10%) in the growth medium can improve membrane protein folding

  • Co-expression with molecular chaperones may enhance soluble expression

What purification strategies are most effective for obtaining functional PgtC protein?

Purification Protocol:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, protease inhibitor cocktail)

  • Disrupt cells by sonication or high-pressure homogenization

  • Isolate membrane fraction by ultracentrifugation (100,000×g for 1 hour)

  • Solubilize membrane proteins with mild detergents (e.g., n-dodecyl-β-D-maltoside (DDM) at 1-2%)

  • Perform IMAC (immobilized metal affinity chromatography) for His-tagged proteins

  • Further purify by size exclusion chromatography in buffer containing 0.02-0.05% DDM

Quality Assessment:

  • Verify purity by SDS-PAGE (>90% purity is desirable)

  • Confirm protein identity by Western blot and/or mass spectrometry

  • Assess protein folding by circular dichroism spectroscopy

  • Functional validation through in vitro interaction assays with PgtB

How does PgtC interact with PgtB to regulate phosphoglycerate transport?

Research indicates that PgtC and PgtB engage in direct protein-protein interactions within the bacterial membrane. Experimental approaches to characterize these interactions include:

  • Bacterial Two-Hybrid Assays: Fusion constructs of PgtC and PgtB domains with split reporter proteins can identify interacting regions.

  • Co-immunoprecipitation: Using antibodies against PgtC to pull down protein complexes and identifying PgtB by Western blotting.

  • Crosslinking Studies: Chemical crosslinkers followed by mass spectrometry analysis can map interaction interfaces.

The experimental evidence demonstrates that PgtC functions to activate and modulate the kinase activity of PgtB, which then phosphorylates PgtA to regulate transcription . Notably, mutations in PgtB near the N-terminus (codons 19 and 21) can lead to constitutive activation even in the absence of PgtC, suggesting these residues form part of the interaction interface .

What methods are effective for studying signal transduction in the PgtABC system?

Methodological Approaches:

  • Phosphotransfer Assays:

    • Purify recombinant PgtA and PgtB proteins

    • Incubate PgtB with [γ-³²P]ATP to observe autophosphorylation

    • Add PgtA to measure phosphotransfer from PgtB to PgtA

    • Analyze by SDS-PAGE and autoradiography

  • Reporter Gene Assays:

    • Construct transcriptional fusions of the pgtP promoter to reporter genes (e.g., lacZ, GFP)

    • Measure reporter activity in various genetic backgrounds (wild-type, ΔpgtC, pgtB mutants)

    • Examine induction in response to phosphoglycerate

  • In vivo Phosphorylation Studies:

    • Use Phos-tag™ SDS-PAGE to detect phosphorylated forms of PgtA and PgtB

    • Perform time-course experiments to track phosphorylation dynamics

    • Compare phosphorylation patterns in wild-type and mutant backgrounds

Recent research has employed a 3PG biosensor system where the S. Typhi PpgtP promoter drives expression of sfGFP, allowing for real-time monitoring of regulatory activity in response to 3PG .

How do mutations in PgtC affect phosphoglycerate transport regulation?

Experimental studies have revealed several key insights regarding PgtC mutations:

  • Deletion Studies: Partial deletion of PgtC (168-bp at the C-terminus) abolishes induction of pgtP expression, indicating essential regions for function .

  • Functional Bypass: Intriguingly, mutations in the partner protein PgtB (at codons 19 and 21) can bypass the requirement for PgtC, suggesting these residues normally participate in PgtC interaction .

  • Complementation Analysis: Wild-type pgtC can restore normal regulated expression when provided in trans to pgtC mutants, confirming its role in modulating PgtB activity .

Table 1: Selected PgtB Mutations That Bypass PgtC Requirement

PlasmidNucleotide ChangeAmino Acid SubstitutionLevel of pgtP Expression
pSJ11R-15GCA→ATAAla-21→IleHigh constitutive
pSJ11R-21GCA→GTAAla-21→ValHigh constitutive
pSJ11R-22CGG→CAGArg-19→GlnModerate constitutive
pSJ11R-24/25CGG→AGGArg-19→Arg (silent)Moderate constitutive

This data demonstrates that PgtC normally functions to activate and modulate the kinase activity of PgtB, and specific mutations can render PgtB constitutively active independent of PgtC .

What computational approaches can predict functional domains in PgtC?

Computational Methodologies:

  • Structural Prediction:

    • AlphaFold2 or RoseTTAFold can generate tertiary structure models

    • TMpred or TMHMM for transmembrane domain prediction

    • PredictProtein for secondary structure analysis

  • Homology Modeling:

    • Identify structural homologs using HHpred

    • Use MODELLER or SWISS-MODEL to generate homology models

    • Validate models using MolProbity and PROCHECK

  • Molecular Dynamics Simulations:

    • Embed PgtC models in simulated membrane bilayers

    • Perform MD simulations to assess stability and conformational changes

    • Identify potential ligand binding sites or protein-protein interaction surfaces

  • Co-evolutionary Analysis:

    • Use methods like Direct Coupling Analysis (DCA) to identify co-evolving residue pairs

    • Predict interaction surfaces between PgtC and PgtB

Such computational approaches can guide targeted experimental studies, particularly for identifying critical residues for mutagenesis .

How can recombinant PgtC be incorporated into Salmonella-based vaccine platforms?

Recombinant attenuated Salmonella vaccines (RASVs) have emerged as promising platforms for delivering heterologous antigens. PgtC can be leveraged in several strategies:

  • Antigen Delivery Systems:

    • Clone pgtC into expression vectors with appropriate promoters

    • Transform into attenuated Salmonella strains (e.g., ΔcyaΔcrp mutants)

    • Test various promoter systems for optimal in vivo expression

  • Promoter Selection Strategies:

    • In vivo-inducible (IVI) promoters like PpagC show higher efficacy at lower doses compared to constitutive promoters like Ptac

    • PpgtC itself could be utilized as an environmentally-responsive promoter for heterologous antigen expression

  • Balanced Attenuation Approach:

    • Engineer strains with regulated delayed attenuation using arabinose-dependent promoters (PBAD)

    • Replace upstream regulatory sequences of essential genes with controllable systems

    • Balance immunogenicity with safety through careful genetic manipulation

Research demonstrates that the RpoS status of S. Typhi vaccine vectors significantly impacts immunogenicity, with RpoS+ vaccines inducing balanced Th1/Th2 responses while RpoS- strains favor Th2 responses .

What safety and efficacy parameters should be evaluated for PgtC-based vaccine constructs?

Comprehensive Evaluation Framework:

  • In Vitro Safety Assessment:

    • Survival in human blood and monocytes

    • Sensitivity to complement

    • Environmental persistence in sewage and surface water

    • Growth characteristics in various media

  • Genetic Stability Testing:

    • Plasmid retention assays under non-selective conditions

    • Sequencing to confirm absence of compensatory mutations

    • Assessment of antigen expression stability over multiple generations

  • Immunological Evaluation:

    • Antibody responses (serum IgG, mucosal IgA)

    • T-cell responses (cytokine profiles, proliferation assays)

    • Protection against challenge with virulent strains

    • Long-term memory response development

  • Dosing Optimization:

    • Determination of minimum effective dose

    • Multiple vs. single dose regimens

    • Route of administration effects (oral, intranasal, etc.)

Research shows that RASVs derived from S. Typhi Ty2 and its derivatives must be carefully evaluated, as some strains (like Ty2) are RpoS-, which can impact colonization and immunogenicity .

How can CRISPR-Cas9 genome editing be applied to study PgtC function in Salmonella?

CRISPR-Cas9 offers powerful approaches for precise genetic manipulation of the pgt system:

Methodological Protocol:

  • sgRNA Design and Validation:

    • Design sgRNAs targeting specific regions of pgtC using tools like CHOPCHOP

    • Test sgRNA efficiency in vitro using purified Cas9 and PCR-amplified targets

    • Select sgRNAs with minimal off-target effects

  • Genome Editing Strategies:

    • Point mutations: Provide repair templates with desired mutations

    • Domain swaps: Replace specific domains with homologs from other species

    • Reporter fusions: Insert fluorescent tags at the C-terminus for localization studies

  • Screening and Validation:

    • PCR and sequencing to confirm edits

    • Western blotting to assess protein expression

    • Functional assays (3PG transport, β-galactosidase reporter assays)

  • Multiplexed Editing:

    • Simultaneously target multiple components of the pgt system

    • Create libraries of variants for high-throughput functional screening

This approach allows for precise manipulation of pgtC without the limitations of traditional homologous recombination methods .

How does the loss of PgtC function affect Salmonella virulence and metabolism in different host environments?

Recent research has revealed fascinating connections between phosphoglycerate metabolism and Salmonella pathogenesis:

  • Host Adaptation and Metabolic Evolution:

    • S. Typhi exhibits loss-of-function mutations in metabolic pathways, including the pgt system

    • While pgtC appears intact in S. Typhi (unlike in S. Paratyphi A where it's clearly degraded), the system is non-functional due to mutations in pgtA (Asp173Gly)

    • This represents convergent evolution between human-adapted serovars despite targeting different components

  • Metabolic Capabilities and Niche Adaptation:

    • 3PG utilization is important for S. Typhimurium intracellular replication and systemic virulence

    • Loss of this metabolic capability in S. Typhi may reflect adaptation to different host niches

    • Similar patterns of metabolic gene silencing are observed for other carbon sources (glucarate, galactarate)

  • Experimental Approaches:

    • Biosensor systems using promoter-reporter fusions

    • Complementation with wild-type genes from related serovars

    • Growth experiments with specific carbon sources

    • In vivo infection models comparing wild-type and genetically complemented strains

These findings highlight how seemingly intact genes can harbor cryptic loss-of-function mutations that contribute to host adaptation and metabolic specialization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.