Recombinant Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
mdoB; opgB; SF4390; S4660; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Shigella flexneri
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQKTLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDSCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWKSKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
Phosphoglycerol transferase I (mdoB) catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links

KEGG: sfl:SF4390

Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of phosphoglycerol transferase I in bacterial cells?

Phosphoglycerol transferase I catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates such as arbutin (p-hydroxyphenyl-β-D-glucoside). This enzymatic reaction produces phosphoglycerol diester derivatives of MDOs or arbutin, with sn-1,2-diglyceride as a secondary product. The enzyme is localized in the inner cytoplasmic membrane of Escherichia coli with its active site oriented toward the outer aspect of this membrane, allowing it to catalyze phosphoglycerol transfer to substrates in the periplasmic space or to arbutin added to the growth medium .

The enzymatic function has been conclusively demonstrated through both biochemical and genetic approaches. Mutations in the mdoB gene, which encodes phosphoglycerol transferase I, result in cells that synthesize MDOs completely devoid of phosphoglycerol residues, providing strong genetic evidence for the enzyme's critical role in MDO phosphoglycerolation .

How does phosphoglycerol transferase I relate to membrane-derived oligosaccharide biosynthesis?

Phosphoglycerol transferase I plays a specific role in the MDO biosynthetic pathway by catalyzing the transfer of phosphoglycerol moieties from phosphatidylglycerol to the growing MDO structure. The enzyme functions within a coordinated pathway that includes multiple enzymes responsible for different aspects of MDO synthesis and modification. Research has established that phosphoglycerol transferase I specifically adds phosphoglycerol residues to MDOs, which distinguishes its function from other enzymes in the pathway, such as the mdoH-encoded glucosyltransferase that is responsible for the synthesis of the MDO core structure .

When phosphoglycerol transferase I activity is absent due to mdoB mutation, MDOs are produced but lack phosphoglycerol modifications entirely. This demonstrates that no other enzyme can compensate for this specific function in vivo, including phosphoglycerol transferase II, which remains active in mdoB mutants but cannot initiate the primary transfer of phosphoglycerol residues to MDOs .

What is the genetic organization of the mdoB locus?

The mdoB gene maps near minute 99 on the E. coli chromosome. Three-factor crosses via P1 transduction have established the gene order as mdoB serB thr in the clockwise direction. This positioning was determined through detailed genetic mapping experiments using insertions of transposable elements such as Tn10 .

The gene encodes the phosphoglycerol transferase I enzyme, and mutations in this locus result in the loss of phosphoglycerol transferase I activity. Multiple alleles of mdoB have been identified, including spontaneous mutations and insertions, all of which lead to the same functional deficit - the inability to transfer phosphoglycerol residues to MDOs or to model substrates like arbutin .

What methods are available for measuring phosphoglycerol transferase I activity?

Phosphoglycerol transferase I activity can be measured using both in vitro and in vivo approaches. In vitro assays typically involve preparing membrane fractions from bacterial cells, incubating them with appropriate substrates, and measuring the transfer of phosphoglycerol residues. The specific activity can be expressed in nmol/h per mg of protein, with wild-type E. coli strains such as AB1133 showing approximately 6.0 nmol/h per mg of protein, while mdoB mutants show activities below the detection limit (<0.05-0.09 nmol/h per mg of protein) .

For in vivo assays, researchers can exploit the enzyme's ability to transfer phosphoglycerol residues to arbutin added to the growth medium. In strains with a dgk mutation (defective in diglyceride kinase), this activity leads to the accumulation of sn-1,2-diglyceride, which can be measured as a proxy for phosphoglycerol transferase I activity .

The following table summarizes the relationship between phosphoglycerol transferase I activity and MDO composition in different strains:

StrainPhosphoglycerol transferase I activity (nmol/h per mg of protein)mol of Phosphoglycerol per mol of MDO
AB1133 mdoB+6.02.0
NFB114 mdoB1<0.050.06
PT227 mdoB::Tn10<0.090.05

How can researchers generate and select for mdoB mutants?

A powerful selection strategy for mdoB mutants exploits the interaction between phosphoglycerol transferase I, arbutin, and the dgk mutation. In strains carrying the dgk mutation (defective in diglyceride kinase), growth in medium containing arbutin leads to the accumulation of sn-1,2-diglyceride due to phosphoglycerol transferase I activity. This accumulation inhibits growth, creating a selective pressure against phosphoglycerol transferase I activity .

To generate mdoB mutants, researchers can start with a dgk strain and select for spontaneous mutants that are resistant to arbutin. Alternatively, transposon mutagenesis using elements like Tn10 can be employed to create insertional mutations. Genetic mapping and complementation tests can then confirm that the mutations are in the mdoB locus. The resulting mutants will lack phosphoglycerol transferase I activity, be resistant to arbutin in a dgk background, and produce MDOs without phosphoglycerol residues .

This selection is highly efficient; the researchers noted that "the selection for arbutin-resistant derivatives of strain RZ60 dgk-6 is sufficiently powerful that prior treatment with Tn10 or other mutagens is not needed" .

What model substrates are used to study phosphoglycerol transferase I?

While MDOs are the physiological substrates for phosphoglycerol transferase I, the enzyme catalyzes the transfer of phosphoglycerol residues to soluble forms of MDO only poorly and at high concentrations. This observation is consistent with the hypothesis that the true physiological substrate is a carrier-bound form of MDO, not the soluble form used in vitro assays .

To overcome this limitation, researchers use model substrates with β-glucoside structures similar to those found in MDOs, but with hydrophobic, aromatic aglycones. The most commonly used model substrate is arbutin (p-hydroxyphenyl-β-D-glucoside), which is effectively utilized by the enzyme both in vitro and in vivo. This has allowed detailed studies of phosphoglycerol transferase I activity despite the challenges of working with the natural substrate .

The use of arbutin has been particularly valuable for in vivo studies because the enzyme can transfer phosphoglycerol residues to arbutin added to the growth medium, allowing researchers to monitor enzymatic activity in living cells .

What is the relationship between phosphoglycerol transferases I and II?

Two distinct phosphoglycerol transferases participate in MDO biosynthesis, but they serve different functions. Phosphoglycerol transferase I (encoded by mdoB) catalyzes the primary transfer of phosphoglycerol residues from phosphatidylglycerol to MDO. In contrast, phosphoglycerol transferase II is a soluble, periplasmic enzyme that catalyzes the interchange of phosphoglycerol residues among soluble species of MDO but does not utilize phosphatidylglycerol as a phosphoglycerol donor .

Experimental evidence clearly demonstrates the functional distinction between these enzymes. Strains with mdoB mutations contain active phosphoglycerol transferase II (specific activity of 0.33 U/mg of protein per h, comparable to the wild-type value of 0.31 U/mg of protein per h), yet their MDOs completely lack phosphoglycerol residues. This confirms that phosphoglycerol transferase II cannot compensate for the absence of phosphoglycerol transferase I in the primary transfer of phosphoglycerol from phosphatidylglycerol to MDO .

How does the absence of phosphoglycerol transferase I affect cellular physiology?

The loss of phosphoglycerol transferase I activity due to mdoB mutation results in the production of MDOs that lack phosphoglycerol residues. This alteration in MDO composition may have implications for membrane properties and cellular physiology, particularly under osmotic stress conditions since MDOs serve as osmoregulated periplasmic glucans .

Interestingly, the relationship between MDO modifications and cellular signaling pathways has been investigated. The activation of the Rcs phosphorelay signal transduction system, which regulates capsular polysaccharide synthesis, has been associated with defects in MDO biosynthesis. Specifically, mutations in mdoH (which lead to complete absence of MDOs) activate the Rcs system. This suggests a potential connection between MDO integrity and cellular stress responses .

While the direct physiological consequences of lacking phosphoglycerol-modified MDOs due to mdoB mutation have not been fully characterized, the conservation of this modification suggests it serves an important function in bacterial adaptation to environmental conditions.

How do phosphatidylglycerol levels influence phosphoglycerol transferase I activity?

Phosphatidylglycerol serves as the donor of phosphoglycerol residues for the reaction catalyzed by phosphoglycerol transferase I. Consequently, mutations that affect phosphatidylglycerol synthesis, such as pgsA mutations, can influence the phosphoglycerol modification of MDOs. The pgsA3 point mutation, which leads to low phosphatidylglycerol content, results in reduced phosphoglycerol modification of MDOs .

In complete pgsA null mutants, MDOs are likely entirely devoid of phosphoglycerol modifications due to the absence of the phosphoglycerol donor. This relationship highlights the interdependence between membrane phospholipid composition and MDO modification, suggesting that phosphoglycerol transferase I activity may be regulated in part by phosphatidylglycerol availability .

How should researchers interpret phenotypes of mdoB mutants compared to other MDO biosynthesis mutants?

When analyzing mdoB mutant phenotypes, researchers should distinguish between effects specific to the absence of phosphoglycerol residues on MDOs and more general effects due to alterations in MDO structure or absence. The mdoB mutation leads specifically to the loss of phosphoglycerol residues on MDOs, while the core oligosaccharide structure remains intact. In contrast, mdoH mutations lead to the complete absence of MDOs .

The differential effects of these mutations on cellular processes can provide insights into the specific roles of different MDO components. For example, the activation of the Rcs signal transduction system has been observed in mdoH mutants, suggesting that the complete absence of MDOs triggers this response. Careful comparison of mdoB and mdoH mutant phenotypes can help determine whether specific cellular responses are triggered by the absence of phosphoglycerol modifications or by more substantial defects in MDO structure .

What controls and standards should be used when studying recombinant phosphoglycerol transferase I?

When working with recombinant phosphoglycerol transferase I, researchers should include appropriate controls to ensure the validity of their results. These should include:

  • Wild-type strains (e.g., AB1133) as positive controls for enzyme activity

  • Characterized mdoB mutants (e.g., PT227 mdoB::Tn10) as negative controls

  • Complementation controls where the mdoB gene is reintroduced into mutant strains to restore activity

For quantitative assays of enzyme activity, standard curves should be established using purified components where possible. When measuring phosphoglycerol content of MDOs, appropriate analytical methods such as colorimetric assays after HF treatment to liberate glycerol provide reliable data .

The table below shows typical lipid composition data that might be obtained when studying phosphoglycerol transferase I, highlighting the importance of using appropriate controls and standardized analytical methods:

StrainPhosphoglycerol transferase I activityMDO phosphoglycerol contentGrowth phenotype with arbutin (dgk background)
Wild-typeHigh (>5 nmol/h per mg)1.5-2.0 mol per mol MDOSensitive
mdoB mutantUndetectable (<0.1 nmol/h per mg)<0.1 mol per mol MDOResistant
Complemented mdoBRestored to near wild-typeRestored to near wild-typeSensitive

What are the key considerations for purifying and characterizing recombinant phosphoglycerol transferase I?

Phosphoglycerol transferase I is an integral membrane protein with its active site oriented toward the periplasmic space. This localization presents challenges for protein purification and characterization. Key considerations include:

  • Membrane solubilization: Appropriate detergents must be selected to extract the enzyme from the membrane while maintaining its native conformation and activity

  • Activity assays: Since the natural substrate (carrier-bound MDO) is difficult to work with in vitro, model substrates like arbutin should be employed

  • Protein orientation: When reconstituting the purified enzyme in artificial membrane systems, the correct orientation must be ensured to maintain activity

  • Lipid environment: The activity of membrane proteins often depends on the surrounding lipid environment, so the composition of the reconstitution mixture may be critical

Researchers should also consider the potential for post-translational modifications or conformational changes that might affect enzyme activity. When expressing recombinant phosphoglycerol transferase I, the expression system should be chosen to ensure proper membrane targeting and folding .

How might structural studies of phosphoglycerol transferase I inform enzyme mechanism understanding?

Structural studies of phosphoglycerol transferase I would be invaluable for understanding its catalytic mechanism. While detailed structural information is not yet available, researchers could employ techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to elucidate the three-dimensional structure of the enzyme. Challenges include the membrane-embedded nature of the protein, which complicates crystallization attempts .

A structural model would reveal the architecture of the active site, identify residues involved in substrate binding and catalysis, and potentially explain how the enzyme achieves specificity for its substrates. This information could be used to design site-directed mutagenesis experiments to confirm mechanistic hypotheses and potentially engineer variants with altered activities or specificities .

The orientation of the active site toward the periplasmic space suggests a specific topology that facilitates interaction with both phosphatidylglycerol in the membrane and MDO substrates in the periplasm. Structural studies could clarify how this orientation enables the enzyme to access both substrates effectively .

What are the potential roles of phosphoglycerol-modified MDOs in bacterial interactions with host systems?

MDOs are periplasmic components that can be released into the extracellular environment, suggesting potential roles in interactions with host systems during infection or colonization. The phosphoglycerol modifications added by phosphoglycerol transferase I might influence these interactions by altering the surface properties or recognition patterns of the released oligosaccharides .

Future research could explore whether phosphoglycerol-modified MDOs serve as microbe-associated molecular patterns (MAMPs) that can be recognized by host pattern recognition receptors, potentially influencing immune responses. Comparative studies of wild-type and mdoB mutant strains in infection models or host cell interaction assays could reveal whether phosphoglycerol modifications affect bacterial virulence or persistence .

Additionally, the potential role of phosphoglycerol-modified MDOs in biofilm formation, antibiotic resistance, or adaptation to host environments remains largely unexplored and represents an exciting direction for future research in the field of bacterial pathogenesis and host-microbe interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.