Recombinant Photobacterium profundum ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
ftsH; PBPRA0604; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-696
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
ftsH
Target Protein Sequence
MWLQVTNCSTLHSSLSYCGANTLSDMAKNLILWLVIAVVLMSVFQSFGPSDSAGRQVDYT TFVREIGQDQIREARFNEREITVFKRDNTRYVTYLPVFNDQKLLDDLINANVKVLGTPPE EPSLLASIFISWFPMLLLIGVWVFFMRQMQGGGGGKGAMSFGKSKARMMSEDQIKTTFAD VAGCDEAKEDVKELVDYLRDPSRFQKLGGKIPTGILLVGPPGTGKTLLAKAIAGEAKVPF FTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGVGGGHDEREQ TLNQMLVEMDGFEGNEGVIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKV HMRKVPLEGDVEPSLIARGTPGFSGADLANLVNEAALFAARGNKRVVSMQEFELAKDKIM MGAERKSMVMSEDQKESTAYHEAGHAIIGRLVPDHDPVYKVSIIPRGRALGVTMYLPEKD RISHSREFLESMLSSLYGGRLAEELIYGVDKVSTGASNDIERATDIARKMVTQWGFSEKM GPVLYADDEGEVFLGRSVTQTKHMSDDTARAIDMEIRALIDRNYERAREILAQNMDIMHA MKDALMKYETIDAAQIDDLMARKSEIRAPKGWGDTDDVMKSSPTTSESAPEAKTESAPEA KAEANVETEEKPVAADSEELKPKAEQAPKEDDKPQA
Uniprot No.

Target Background

Function
This recombinant *Photobacterium profundum* ATP-dependent zinc metalloprotease FtsH (ftsH) functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is FtsH and what role does it play in P. profundum?

FtsH is an ATP-dependent membrane-bound zinc metalloprotease that belongs to the AAA family of ATPases. In P. profundum, as in other bacteria, it plays essential roles in protein quality control, degrading misfolded or damaged membrane proteins. FtsH is the only essential energy-dependent protease in many bacteria, including Escherichia coli . In P. profundum specifically, it likely contributes to the organism's ability to survive in deep-sea environments by maintaining protein homeostasis under high pressure conditions.

How does P. profundum FtsH compare with FtsH homologs from other bacteria?

P. profundum FtsH shares significant homology with FtsH from other bacteria, particularly within the Vibrionaceae family. The protein contains the characteristic AAA ATPase domain and zinc metalloprotease motif. While the core functional domains are conserved, there may be adaptations in the P. profundum FtsH that allow it to function optimally under high pressure conditions, such as specific amino acid substitutions that maintain protein flexibility at elevated pressures.

What expression systems are most effective for producing recombinant P. profundum FtsH?

E. coli is the most commonly used heterologous expression system for P. profundum FtsH. Based on the available literature, recombinant full-length P. profundum FtsH has been successfully expressed in E. coli with an N-terminal His-tag . When expressing membrane proteins like FtsH, specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for toxic or membrane protein expression, may improve yields.

What are the critical considerations for obtaining functionally active recombinant FtsH?

Several factors are critical for obtaining functionally active FtsH:

  • Induction conditions: Lower temperatures (15-20°C) during induction often improve folding of complex proteins from psychrotolerant organisms.

  • Metal incorporation: As a zinc metalloprotease, proper incorporation of zinc is essential for activity. Supplementing growth media with ZnCl₂ (10-50 μM) may improve enzyme activity.

  • Membrane domain handling: Full-length FtsH contains a membrane domain that can complicate expression and purification. For functional studies, researchers often use constructs lacking the transmembrane domain while maintaining the ATPase and protease domains.

  • Buffer conditions: Inclusion of glycerol (10-20%) and reducing agents in purification buffers helps maintain protein stability.

What purification strategies yield the highest purity and activity?

A multi-step purification process typically yields the best results:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged constructs.

  • Intermediate purification: Ion exchange chromatography (typically Q-Sepharose).

  • Polishing: Size exclusion chromatography to separate aggregates and obtain homogeneous protein.

Buffer composition typically includes:

  • 50 mM Tris-HCl or HEPES (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 5-10% glycerol

  • 1-5 mM β-mercaptoethanol or DTT

  • 0.05-0.1% non-ionic detergent (for full-length constructs)

How is FtsH activity measured in vitro?

Several assays are used to measure FtsH activity:

  • Proteolytic activity assays:

    • Using fluorogenic peptide substrates containing a quenched fluorophore that is released upon cleavage

    • Following degradation of model substrates (such as casein or the 23-kD D1 fragment) by SDS-PAGE

    • Monitoring ATP hydrolysis that occurs concomitantly with proteolysis

  • ATP hydrolysis assays:

    • Colorimetric assays measuring inorganic phosphate release

    • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

A typical reaction buffer contains:

  • 50 mM Tris-HCl (pH 8.0)

  • 5 mM MgCl₂

  • 2 mM ATP

  • 1 mM DTT

  • 10-20 μM ZnCl₂

What are the known substrates for P. profundum FtsH?

The specific natural substrates of P. profundum FtsH have not been fully characterized, but based on homology with other bacterial FtsH proteins, potential substrates include:

  • Misfolded membrane proteins

  • Regulatory proteins involved in stress response

  • Proteins involved in cell division

In experimental settings, β-casein has been used as a model substrate for FtsH proteolytic activity . For FtsH from photosynthetic organisms, the D1 protein of photosystem II is a well-characterized substrate .

How do environmental factors affect FtsH activity?

P. profundum is a piezophilic organism adapted to deep-sea environments. Several environmental factors affect FtsH activity:

Environmental FactorEffect on FtsH ActivityAdaptation in P. profundum
PressureActivity modulationOptimized activity at moderate pressures (10-22 MPa)
TemperatureRate changesActive at low temperatures (4-15°C)
Salt concentrationStability changesAdapted for marine environments (3-3.5% NaCl)
Zinc availabilityEssential for catalysisHigh-affinity zinc binding

P. profundum shows optimal growth at moderate pressures around 10 MPa, defining it as mesophile and moderately piezophile . The FtsH enzyme likely shows similar adaptation patterns.

Is FtsH expression regulated by pressure in P. profundum?

While the specific pressure regulation of FtsH in P. profundum has not been directly reported in the search results, it likely follows patterns similar to other proteins involved in stress response and membrane maintenance. P. profundum SS9 contains a ToxR-mediated gene regulation system that responds to pressure signals . ToxR is a transmembrane DNA binding protein that mediates gene expression in response to environmental signals, including pressure.

RNA arbitrarily primed PCR (RAP-PCR) studies comparing wild-type and toxR mutant strains of P. profundum SS9 have identified several ToxR-regulated genes involved in membrane structure alteration and starvation response . Given FtsH's role in membrane protein quality control, it may be part of this regulatory network.

How does FtsH contribute to piezoadaptation in deep-sea bacteria?

FtsH likely contributes to piezoadaptation through several mechanisms:

  • Membrane protein quality control: High pressure affects membrane fluidity and protein folding. FtsH may degrade misfolded membrane proteins that accumulate under pressure stress.

  • Regulation of membrane composition: Deep-sea bacteria including P. profundum adapt to high pressure by altering membrane lipid composition, particularly increasing unsaturated fatty acids . FtsH may indirectly participate in this process by degrading proteins involved in lipid metabolism.

  • Stress response regulation: FtsH might regulate the levels of stress response regulators, helping the cell respond to pressure changes.

What experimental approaches can be used to study FtsH function under high pressure?

Studying FtsH under high pressure requires specialized equipment and methodologies:

  • High-pressure vessels: Custom-designed pressure vessels for bacterial culture and biochemical assays.

  • Pressure-resistant spectroscopic cells: For measuring enzymatic activity under pressure.

  • Transcriptomic approaches: RNA-seq or microarray analysis comparing gene expression at different pressures.

  • Gene knockout studies: Creating ΔftsH mutants and examining their growth and survival under different pressure conditions.

  • In vitro activity assays under pressure: Measuring protease activity at various pressures using high-pressure stopped-flow devices.

  • Structural studies: X-ray crystallography or cryo-EM at different pressures to understand conformational changes.

How does P. profundum FtsH differ from FtsH in non-piezophilic bacteria?

Comparative genomic analysis of piezophilic bacteria like P. profundum and non-piezophilic bacteria can reveal adaptations in FtsH that facilitate function under high pressure:

  • Amino acid composition: Piezophilic proteins often contain fewer bulky hydrophobic amino acids and more small residues to maintain flexibility under pressure.

  • Structural flexibility: The catalytic domains may have specific adaptations allowing conformational changes under pressure.

  • Substrate specificity: P. profundum FtsH may have evolved to recognize specific substrates that are crucial for piezoadaptation.

What can comparative genomics reveal about FtsH evolution in marine bacteria?

Comparative genomics approaches have been valuable in understanding adaptations of deep-sea bacteria . For FtsH specifically:

  • Core proteome analysis: Approximately 35% of virulence-associated proteins in Vibrio species (relatives of Photobacterium) have orthologs in the core proteome of Vibrionaceae , suggesting dual roles for many proteins.

  • Pressure-specific adaptations: Comparison of orthologous proteins between piezophilic and non-piezophilic strains can identify pressure-specific adaptations in protein sequence and structure.

  • Horizontal gene transfer: Analysis of genomic islands can reveal if FtsH has been acquired or modified through horizontal gene transfer events.

How can directed evolution be used to study FtsH function and adaptation?

Directed evolution provides powerful approaches to understand FtsH function and adaptation:

  • Random mutagenesis: Creating libraries of FtsH variants and selecting for enhanced activity under different pressure conditions.

  • Domain swapping: Exchanging domains between FtsH from piezophilic and non-piezophilic bacteria to identify regions responsible for pressure adaptation.

  • Ancestral sequence reconstruction: Reconstructing ancestral FtsH sequences to understand the evolutionary trajectory of pressure adaptation.

  • Selection experiments: Evolving E. coli expressing P. profundum FtsH under pressure to identify compensatory mutations that enhance function.

How can recombinant P. profundum FtsH be used to study membrane protein quality control?

Recombinant P. profundum FtsH offers unique opportunities to study membrane protein quality control:

  • Reconstitution systems: Incorporating purified FtsH into liposomes or nanodiscs to study its activity in a membrane environment.

  • Substrate identification: Using proteomics approaches (such as SILAC) to identify natural substrates by comparing proteomes with and without active FtsH.

  • Structure-function studies: Site-directed mutagenesis to identify residues critical for substrate recognition, ATP hydrolysis, and protease activity.

  • High-pressure adaptation studies: Comparing the activity and substrate specificity of FtsH from P. profundum with FtsH from non-piezophilic bacteria.

What are the technical challenges in studying FtsH function under high pressure conditions?

Several technical challenges complicate the study of FtsH under high pressure:

  • Equipment limitations: Standard laboratory equipment is not designed for high-pressure experiments.

  • In situ measurements: Difficulty in measuring enzymatic activity in real-time under pressure.

  • Protein stability: Maintaining protein stability during pressure transitions.

  • Expression systems: Creating expression systems that accurately reflect the native conditions of P. profundum.

  • Membrane environment recreation: Reproducing the native membrane environment of P. profundum, which has specific lipid compositions adapted to high pressure.

How might insights from P. profundum FtsH inform understanding of protein quality control in extreme environments?

Studying P. profundum FtsH can provide broader insights into protein quality control under extreme conditions:

  • Adaptation principles: Identifying general principles of protein adaptation to high pressure that may apply to other extremophiles.

  • Novel mechanisms: Discovering new mechanisms of protein quality control that have evolved in extreme environments.

  • Biotechnological applications: Developing enzymes with enhanced stability and activity under non-standard conditions.

  • Astrobiology implications: Understanding how life might adapt to extreme environments on other planets or moons with high-pressure environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.