Recombinant Photobacterium profundum Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Overview of DsbB in Gram-Negative Bacteria

DsbB is an integral membrane protein critical for disulfide bond formation in periplasmic proteins, a process essential for protein stability and bacterial virulence . In E. coli, DsbB oxidizes the periplasmic protein DsbA, which directly introduces disulfide bonds into substrate proteins . DsbB itself is reoxidized by transferring electrons to membrane-bound quinones (ubiquinone or menaquinone) .

Functional Mechanism

The electron transfer pathway in E. coli DsbB involves:

  1. DsbA oxidation: DsbA transfers electrons to DsbB via Cys104-Cys130 .

  2. Intramolecular disulfide shuffling: Electrons move from Cys104-Cys130 to Cys41-Cys44 .

  3. Quinone reduction: Cys44 donates electrons to ubiquinone, regenerating oxidized DsbB .

This mechanism is likely conserved in P. profundum, given the structural and functional conservation of DsbB homologs .

Role in Bacterial Physiology and Virulence

DsbB is indispensable for:

  • Protein folding: Proper disulfide bond formation in secreted proteins (e.g., toxins, adhesins) .

  • Virulence: Pathogens lacking DsbB exhibit reduced infectivity due to misfolded virulence factors .

    • Example: Vibrio cholerae DsbB mutants fail to produce cholera toxin .

Comparative Analysis of DsbB Homologs

FeatureE. coli DsbB P. profundum DsbB (Inferred)
GenedsbBHomolog of dsbB
Molecular Weight~21 kDaSimilar (~20–25 kDa)
Membrane Topology4 TM helicesLikely 4 TM helices
Active CysteinesCys41-Cys44, Cys104-Cys130Conserved CXXC motifs
Electron AcceptorUbiquinone/MenaquinoneLikely quinones
Role in VirulenceEssential for pathogenicityPresumed critical for survival

Research Gaps and Future Directions

No studies on recombinant P. profundum DsbB were identified in the provided sources. Key areas for investigation include:

  • Structural characterization: Cryo-EM or NMR studies to resolve its membrane-embedded conformation .

  • Kinetic assays: Measuring redox potentials and quinone interaction efficiency .

  • Biotechnological applications: Engineering P. profundum DsbB for industrial protein folding systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are flexible to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal quality, aliquot the protein for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, kindly inform us and we will prioritize development according to your specification.
Synonyms
dsbB; PBPRA2610; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
dsbB
Target Protein Sequence
MQFLNTFSKSRISWLLLLLCIVFFEGSALFFQHGMKLGPCVMCIYERVAMMGIAFAALLG AIAPQYAIIRWAGLIAWGYSAVRGLQLSIEHVGYQFNPSPFATCDLFVQFPNWAPLNKWV PWMFEAYGNCAEVVWTFLGQSMPQWLVIIFAGNLVALALIVIAQFFSKKTNTILDM
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain periplasmic proteins. It acts by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photobacterium profundum dsbB and what is its role in bacterial physiology?

Disulfide bond formation protein B (dsbB) in Photobacterium profundum is a membrane protein involved in the formation of disulfide bonds in the bacterial periplasm. It functions as part of the Dsb system that catalyzes the oxidative folding of secreted proteins. In P. profundum, a piezophilic (pressure-loving) deep-sea bacterium, dsbB likely plays a crucial role in maintaining proper protein folding under high hydrostatic pressure conditions. P. profundum was originally isolated from the Sulu Sea and has become an established model organism for studying high-pressure adaptation due to its ability to grow across a wide range of pressures (0.1 MPa to 70 MPa) .

How does the expression of dsbB in P. profundum relate to pressure adaptation?

While specific information on dsbB expression patterns in P. profundum is not extensively documented, we can infer its importance from pressure adaptation studies. Since P. profundum adapts to different pressure environments by modifying protein expression profiles, dsbB likely plays a role in this adaptation process. Proteomic analyses have shown that proteins involved in key metabolic pathways are differentially expressed under varying pressure conditions . The dsbB protein may be regulated as part of the stress response system that helps P. profundum adapt to high pressure environments by ensuring proper folding of membrane and periplasmic proteins essential for cellular function under extreme conditions.

What structural features distinguish P. profundum dsbB from homologs in non-piezophilic bacteria?

P. profundum dsbB likely contains structural adaptations that enable function under high pressure conditions. These may include amino acid substitutions that provide conformational flexibility or stability at elevated pressures. While specific structural data on P. profundum dsbB is limited, it is known that piezophilic proteins often contain fewer large hydrophobic amino acid residues and more small residues to maintain flexibility under pressure. Based on studies of other pressure-adapted proteins in P. profundum, dsbB may have specialized transmembrane domains that remain functional at 28 MPa (its optimal growth pressure) .

What are the optimal conditions for expressing recombinant P. profundum dsbB?

For expressing recombinant P. profundum dsbB, researchers should consider the following protocol:

  • Host selection: E. coli strains lacking endogenous dsbB (such as dsbB deletion mutants) are preferable to avoid interference.

  • Temperature conditions: Expression at 15-17°C is recommended to mimic P. profundum's natural environment.

  • Growth media: Marine broth supplemented with 20 mM glucose and 100 mM HEPES buffer (pH 7.5) has been successfully used for P. profundum cultures .

  • Pressure considerations: For native-like folding, consider using pressure vessels capable of 28 MPa during expression or refolding steps.

  • Induction parameters: Low inducer concentrations and extended expression times (24-48 hours) at lower temperatures likely yield better results for membrane proteins from psychrophilic organisms.

How can researchers effectively purify recombinant P. profundum dsbB while maintaining activity?

Purification of recombinant P. profundum dsbB requires careful handling to preserve the membrane protein's activity:

  • Cell lysis: Gentle disruption methods such as osmotic shock or mild detergent treatment are preferable to harsh sonication.

  • Detergent selection: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended for membrane protein extraction.

  • Chromatography sequence:

    • Initial IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Size exclusion chromatography for further purification and detergent exchange

  • Buffer composition: Include stabilizing agents such as glycerol (10-15%) and maintain physiologically relevant salt concentrations (similar to marine environments).

  • Temperature control: Maintain samples at 4-10°C throughout purification to preserve activity of this psychrophilic protein.

  • Activity verification: Measure disulfide oxidoreductase activity using standard assays with appropriate adjustments for pressure adaptation.

What assays can be used to measure P. profundum dsbB activity under different pressure conditions?

To assess dsbB activity under varying pressure conditions, researchers can implement these approaches:

  • Fluorescent substrate monitoring: Use pressure-resistant fluorescence assays with DiS-C3-(5) or similar probes that can detect disulfide formation activity.

  • Coupled enzyme assays: Measure activity through regeneration of oxidized quinones in a pressure chamber setup.

  • Pressure chamber experiments:

    • Utilize high-pressure vessels similar to those used for P. profundum cultivation (up to 90 MPa)

    • Compare enzyme kinetics at atmospheric pressure (0.1 MPa) versus optimal growth pressure (28 MPa)

  • Redox state analysis: Assess the oxidation state of dsbB's catalytic cysteines using alkylation approaches followed by mass spectrometry.

  • Thermal stability assays: Combine with pressure treatment to determine pressure effects on protein stability using differential scanning fluorimetry.

How does P. profundum dsbB interact with the transcriptional regulator ToxR under varying pressure conditions?

ToxR is a transmembrane DNA-binding protein that regulates numerous genes in P. profundum in a pressure-dependent manner . The potential interaction between dsbB and the ToxR regulatory system represents an intriguing research direction:

  • Co-expression patterns: RNA-seq data has revealed complex expression patterns for pressure-regulated genes in P. profundum , and dsbB may be part of the ToxR regulon.

  • Functional relationship: ToxR influences outer membrane protein expression, which may require proper disulfide bond formation mediated by dsbB for correct folding and insertion.

  • Regulatory interactions: The activity and abundance of ToxR are influenced by hydrostatic pressure , potentially requiring dsbB-mediated disulfide bond formation for proper sensing or signal transduction.

  • Experimental approaches:

    • ChIP-seq to identify potential ToxR binding sites in dsbB promoter regions

    • Expression analysis comparing dsbB mRNA/protein levels in wild-type versus toxR mutant strains under different pressure conditions

    • Co-immunoprecipitation studies to detect physical interactions between ToxR and components of the disulfide bond formation pathway

What role does dsbB play in the differential expression of proteins involved in P. profundum's metabolic pathways under varying pressure?

Proteomic analysis has revealed that proteins involved in glycolysis/gluconeogenesis are up-regulated at high pressure, while oxidative phosphorylation components are up-regulated at atmospheric pressure in P. profundum . The role of dsbB in these metabolic shifts may include:

  • Direct effects on metabolic enzyme folding: dsbB may facilitate proper folding of pressure-regulated enzymes containing disulfide bonds.

  • Redox balance maintenance: dsbB could influence the cellular redox state, affecting metabolic pathway regulation under different pressure conditions.

  • Membrane protein stabilization: dsbB-mediated disulfide formation may help stabilize membrane transporters essential for nutrient uptake, which has been shown to be modulated by pressure in P. profundum .

  • Research approach:

    • Comparative proteomic analysis of wild-type versus dsbB mutant strains at different pressures

    • Targeted metabolomics to identify metabolic bottlenecks in dsbB-deficient strains

    • Analysis of disulfide bond formation in key metabolic enzymes with predicted disulfide bonds

How can insights from P. profundum dsbB be applied to understanding protein folding mechanisms in other extremophiles?

The study of P. profundum dsbB offers valuable insights into protein folding under extreme conditions:

  • Comparative genomics approach: Analyzing dsbB sequence variation across piezophiles, psychrophiles, and mesophiles can reveal evolutionary adaptations to extreme environments.

  • Structure-function relationships: Identifying pressure-specific adaptations in P. profundum dsbB may reveal general principles of protein stabilization under extreme conditions.

  • Biotechnological applications: Engineering pressure-resistant disulfide bond formation systems based on P. profundum dsbB could enhance recombinant protein production of difficult-to-fold proteins.

  • Research methodology:

    • Homology modeling of dsbB from various extremophiles

    • Site-directed mutagenesis to transfer pressure-adaptive features to mesophilic homologs

    • Heterologous expression systems to test functionality across pressure/temperature ranges

What are common challenges in expressing functional recombinant P. profundum dsbB and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant P. profundum dsbB:

  • Inclusion body formation:

    • Solution: Lower expression temperature to 10-15°C and reduce inducer concentration

    • Use specialized E. coli strains designed for membrane protein expression

    • Consider fusion tags that enhance solubility (e.g., MBP)

  • Poor membrane integration:

    • Solution: Use E. coli strains with enhanced membrane protein insertion machinery

    • Optimize induction timing to prevent overwhelming the membrane insertion apparatus

    • Consider cell-free expression systems with supplied lipids or nanodiscs

  • Insufficient activity:

    • Solution: Ensure proper redox environment during expression and purification

    • Supplement with appropriate quinone cofactors

    • Verify proper disulfide bond formation using non-reducing SDS-PAGE

  • Instability during purification:

    • Solution: Screen multiple detergents for optimal extraction and stability

    • Include stabilizing agents such as glycerol and appropriate salt concentrations

    • Consider purification under pressure to maintain native conformation

How can researchers distinguish between pressure effects and cold adaptation effects when analyzing P. profundum dsbB function?

Distinguishing between pressure and temperature adaptations requires careful experimental design:

  • Orthogonal variable testing:

    • Perform activity assays in a matrix of temperatures (0-25°C) and pressures (0.1-70 MPa)

    • Compare with homologs from related bacteria adapted to different conditions:

      • P. profundum strain 3TCK (cold-adapted but not pressure-adapted)

      • P. profundum strain SS9 (both cold and pressure-adapted)

  • Mutational analysis:

    • Identify amino acids unique to piezophilic dsbB and introduce them into mesophilic homologs

    • Test if these mutations confer pressure resistance, cold adaptation, or both

  • Structural characterization:

    • Analyze protein dynamics using hydrogen-deuterium exchange mass spectrometry at different pressures and temperatures

    • Identify regions with differential flexibility/rigidity under various conditions

  • Data analysis framework:

    • Apply multivariate statistical approaches to distinguish temperature vs. pressure effects

    • Use principal component analysis to identify which protein features correlate with each environmental variable

What are the most effective approaches for studying the in vivo function of dsbB in P. profundum considering its pressure requirements?

Studying dsbB function in vivo presents unique challenges due to P. profundum's pressure requirements:

  • Genetic manipulation strategies:

    • Leverage P. profundum's ability to grow at atmospheric pressure for genetic manipulation

    • Construct conditional mutants or depletion strains rather than complete knockouts if dsbB is essential

    • Use plasmid-based complementation similar to approaches used for recD studies in P. profundum

  • High-pressure cultivation systems:

    • Design experiments using specialized pressure vessels similar to those described for P. profundum cultivation

    • Implement systems that allow sampling without completely releasing pressure

  • In vivo protein interaction studies:

    • Adapt bacterial two-hybrid systems to function under pressure

    • Develop fluorescent protein fusions that remain stable and functional at high pressure

    • Use in vivo crosslinking followed by mass spectrometry to capture transient interactions

  • Phenotypic characterization:

    • Monitor growth rates, morphology, and stress responses at varying pressures

    • Assess global protein oxidation states using redox proteomics

    • Measure membrane integrity and permeability as indicators of proper membrane protein folding

How does P. profundum dsbB differ functionally from E. coli dsbB, and what implications does this have for heterologous expression?

Functional differences between P. profundum and E. coli dsbB have important implications:

  • Comparative activity profile:

    ParameterP. profundum dsbBE. coli dsbBImplications
    Optimal temperature10-15°C37°CLower expression temperature required
    Pressure toleranceUp to 70 MPa0.1 MPa (atmospheric)Potential conformational changes at high pressure
    Quinone specificityPotentially adapted for low-temperature electron transferOptimized for mesophilic conditionsMay require specific quinone supplements
    Membrane composition compatibilityAdapted to high PUFA content membranesStandard phospholipid compositionConsider membrane mimetics for optimal function
  • Heterologous expression considerations:

    • E. coli expression systems may not provide the appropriate membrane environment

    • Consider supplementing growth media with membrane components similar to those in P. profundum

    • Expression in Antarctic bacteria or other psychrophiles might yield better results than standard E. coli

  • Research approaches:

    • Domain swapping between E. coli and P. profundum dsbB to identify pressure-adaptive regions

    • Complementation studies in E. coli dsbB mutants under various pressure conditions

    • Membrane composition modification to better accommodate P. profundum dsbB

What can genomic and proteomic data tell us about the evolution of dsbB in piezophilic bacteria compared to surface-dwelling relatives?

Evolutionary analysis of dsbB across bacterial species reveals adaptive patterns:

  • Sequence conservation patterns:

    • Catalytic cysteine residues remain highly conserved across pressure gradients

    • Transmembrane domains show higher variation in piezophilic species, potentially adapting to pressure-induced membrane changes

    • Quinone-binding sites may show adaptations for function at high pressure

  • Genomic context analysis:

    • Examine if dsbB genomic location differs between piezophilic and non-piezophilic bacteria

    • Identify if dsbB is part of pressure-regulated operons in P. profundum

    • Compare promoter regions for potential ToxR binding sites across species

  • Proteomic evidence:

    • In P. profundum, stress response genes are differentially regulated under pressure conditions

    • dsbB expression patterns may correlate with other proteins involved in membrane homeostasis

    • Post-translational modifications might differ between piezophilic and mesophilic dsbB proteins

  • Research methodology:

    • Phylogenetic analysis comparing dsbB across the Vibrionaceae family

    • Selection pressure analysis (dN/dS ratios) to identify positively selected residues

    • Ancestral sequence reconstruction to trace the evolution of pressure adaptation

How might P. profundum dsbB interact with the bacterial stress response system under fluctuating pressure conditions?

The relationship between dsbB and stress response systems offers promising research opportunities:

  • Potential interactions with pressure-responsive genes:

    • In P. profundum, several stress response genes (htpG, dnaK, dnaJ, groEL) are upregulated at atmospheric pressure

    • dsbB may functionally interact with these chaperones to maintain protein homeostasis

    • Investigate if dsbB is co-regulated with these stress-response genes

  • Role in oxidative stress management:

    • High pressure environments have different oxygen solubility characteristics

    • dsbB's involvement in disulfide bond formation impacts cellular redox balance

    • Explore connections between pressure adaptation and oxidative stress response pathways

  • Research approaches:

    • Transcriptomic analysis of dsbB expression during pressure shifts

    • Proteomic identification of dsbB interaction partners under stress conditions

    • Phenotypic characterization of dsbB mutants under combined pressure and oxidative stress

What role might dsbB play in the adaptation of P. profundum membrane composition in response to pressure?

The connection between dsbB and membrane adaptation represents an important research area:

  • Membrane composition changes:

    • P. profundum alters its fatty acid chains in response to pressure and temperature

    • dsbB, as a membrane protein, may function differently in membranes of varying composition

    • dsbB might be involved in the proper folding of enzymes responsible for membrane lipid modification

  • Pressure sensing mechanisms:

    • Membrane fluidity changes are a primary signal of pressure variation

    • dsbB might participate in signaling cascades that detect and respond to pressure-induced membrane alterations

    • Explore if dsbB interacts with pressure-sensing components like ToxR

  • Experimental approaches:

    • Lipidomic analysis comparing wild-type and dsbB-mutant strains

    • Reconstitution of dsbB in liposomes of varying composition

    • Pressure-dependent activity assays in different membrane mimetics

How can structural biology approaches be adapted to study P. profundum dsbB under native pressure conditions?

Innovative structural biology methods can provide insights into pressure-adapted proteins:

  • High-pressure NMR spectroscopy:

    • Allows direct observation of protein structure under high pressure

    • Can capture pressure-induced conformational changes in real-time

    • Requires specialized high-pressure NMR cells and isotope labeling

  • High-pressure X-ray crystallography:

    • Diamond anvil cells can maintain protein crystals under high pressure

    • May reveal pressure-specific conformational states

    • Challenging for membrane proteins but increasingly feasible with modern synchrotron sources

  • Cryo-EM under pressure:

    • Emerging techniques for sample vitrification under pressure

    • Could capture native conformational states of dsbB in membrane environments

    • Requires specialized equipment development

  • Molecular dynamics simulations:

    • Computational modeling of dsbB behavior under varying pressure conditions

    • Can generate testable hypotheses about pressure-specific conformational changes

    • Should be validated with experimental structural data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.