Recombinant Photobacterium profundum Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Overview of Photobacterium profundum

Photobacterium profundum is a marine bacterium notable for its capacity to grow in extreme environments, specifically at low temperatures and high hydrostatic pressures . Its adaptation to such conditions has made it a subject of interest in microbial ecology and molecular biology . Researchers have studied multiple strains of P. profundum to understand their survival mechanisms and unique physiological adaptations .

Fumarate Reductase and its Significance

Fumarate reductase is crucial for anaerobic respiration, allowing bacteria to generate energy in the absence of oxygen . This enzyme complex is embedded in the cytoplasmic membrane and facilitates the transfer of electrons from a donor molecule to fumarate, producing succinate . The process is essential for maintaining the cellular redox balance and energy production under anaerobic conditions .

Role of frdC Subunit

The fumarate reductase enzyme complex consists of several subunits, each with a specific function. The frdC subunit anchors the enzyme to the membrane and participates in electron transfer . Specifically, frdC is a membrane-spanning protein that forms part of the quinol oxidation site, facilitating the entry of electrons into the enzyme complex .

Research Findings and Mutant Studies

Studies involving P. profundum have explored the function and importance of fumarate reductase through genetic and biochemical experiments . Mutants with deletions in key genes, such as flaB and motA1, exhibit defects in motility under high-pressure and high-viscosity conditions, indicating the importance of these genes for adaptation to extreme environments . These gene expression studies demonstrate how P. profundum adapts to high-pressure environments at the molecular level .

Adaptation to High-Pressure Conditions

P. profundum employs several strategies to adapt to high-pressure conditions, including modifying its membrane lipid composition and utilizing specialized motility systems . The bacterium's ability to increase swimming velocity under pressure, as observed in strain SS9, contrasts with the behavior of bacteria like Escherichia coli, which experience a decrease in motility with increasing pressure .

Potential Applications and Further Research

The study of P. profundum and its enzymes, including fumarate reductase, offers insights into the enzymatic adaptations required for life in extreme environments. Further research could explore the biotechnological potential of these enzymes, such as their use in industrial processes under high-pressure conditions. Additionally, understanding the genetic and molecular mechanisms that underpin these adaptations may provide valuable knowledge for synthetic biology and other applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; PBPRA3380; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
frdC
Target Protein Sequence
MSNRKPYVREMTRTWWKDDPFYRFYMVREATILPLIFFTICLTFGLGCLVKGPEAWAGWL SFMSNPIVVVLNILALLGSLFHAQTFFSMMPQVMPITIKGKKLDKTIIVLAQWAAVAAIS LFVLVLV
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photobacterium profundum and why is it relevant for studying fumarate reductase?

Photobacterium profundum is a cosmopolitan marine bacterium capable of growth at low temperatures and high hydrostatic pressures. Multiple strains have been isolated from different ocean depths, displaying remarkable differences in their physiological responses to pressure . The deep-sea piezopsychrophilic strain SS9 has been particularly well-studied, with its genome sequence providing insights into genetic features required for growth in the deep sea . P. profundum serves as an excellent model organism for studying pressure-adapted proteins, including respiratory chain components like fumarate reductase, which may exhibit unique structural and functional properties compared to their shallow-water counterparts.

How do different strains of P. profundum differ in their pressure adaptation mechanisms?

The genome sequence comparison between piezophilic strain SS9 (isolated from the deep sea) and non-piezophilic strain 3TCK (isolated from shallow water) has revealed significant differences that define their respective ecological niches . These differences range from variations in gene content to specific gene sequences under positive selection . Strain SS9 demonstrates optimal growth at high hydrostatic pressure (28 MPa), while 3TCK grows optimally at atmospheric pressure (0.1 MPa) . These adaptations likely affect the structure and function of membrane proteins like fumarate reductase, which must maintain functionality under different pressure conditions.

What culture conditions are recommended for expressing recombinant proteins in P. profundum?

For standard laboratory cultivation of P. profundum, researchers should use:

ParameterRecommendationNotes
Medium75% strength 2216 Marine Medium (28 g/L)As described in multiple studies
Temperature15°COptimal for most strains
PressureStrain-dependent (0.1 MPa for 3TCK, 28 MPa for SS9)High-pressure cultivation requires special equipment
Antibiotics (if needed)Chloramphenicol (200 μg/ml) or Streptomycin (150 μg/ml)For plasmid maintenance

For high-pressure growth experiments, cultures should be prepared in heat-sealable plastic bulbs containing media without gas space, then placed in pressure vessels as described in previous studies .

What genetic tools are available for heterologous expression in P. profundum?

Based on the experimental approaches described in the literature, several genetic tools have been successfully applied to P. profundum:

  • Tri-parental conjugations using helper E. coli strain pRK2073 for introducing plasmids

  • Broad-host-range plasmids like pGL10 for gene expression

  • Gene disruption techniques using vectors like pMUT100

  • Complementation assays using rescued plasmids ranging from 8-15 kb in size

For expressing recombinant frdC, researchers typically use expression vectors with inducible promoters that function in marine bacteria.

What methodological approaches are most effective for studying recombinant frdC function under high pressure?

Studying proteins under high pressure requires specialized equipment and methodologies:

  • High-pressure cultivation systems: Use pressure vessels with heat-sealed plastic bulbs containing cultures without gas space .

  • Pressure-adapted assay systems: For enzymatic activity measurements, consider using pressure-resistant cuvettes and specialized spectrophotometers designed for high-pressure work.

  • Comparative analysis: Always compare protein function between pressure-adapted (SS9) and pressure-sensitive (3TCK) strains to identify pressure-specific adaptations .

  • Molecular dynamics simulations: Complement experimental data with in silico analysis of protein structure under different pressure conditions.

  • Site-directed mutagenesis: Identify key residues responsible for pressure adaptation by creating targeted mutations and testing their effects on protein function under different pressures.

How can genomic differences between P. profundum strains inform recombinant frdC expression strategies?

The genomic comparison between SS9 and 3TCK strains provides valuable insights for optimizing recombinant expression:

  • Promoter selection: Analyze strain-specific promoter regions for optimal expression. The research on promoter regions in P. profundum suggests strain-specific regulation may affect expression levels . For example, experiments with promoter regions demonstrated that they could be PCR amplified and cloned into expression vectors using restriction enzymes like EcoRI .

  • Codon optimization: Analyze codon usage bias in different strains to optimize coding sequences for maximal expression.

  • Regulatory elements: Consider strain-specific transcriptional regulators when designing expression constructs. For example, RNA polymerase sigma factors of the ECF subfamily have been identified in P. profundum and may influence gene expression under different conditions .

  • Genomic context: Consider the genomic neighborhood of the native frdC gene, as it may contain important regulatory elements or operonic structures affecting expression.

What challenges might arise when purifying recombinant frdC from P. profundum, and how can they be addressed?

Purifying membrane proteins like fumarate reductase subunit C presents several challenges, particularly from pressure-adapted organisms:

  • Membrane destabilization: High-pressure adaptation affects membrane composition and protein-lipid interactions. Use gentle detergents and consider purification under pressure.

  • Protein stability: Pressure-adapted proteins may destabilize at atmospheric pressure. Consider using pressure-stable buffers with osmolytes that maintain protein integrity.

  • Extraction protocols: Modify standard protocols based on P. profundum strain characteristics. For genomic DNA extraction from strain 3TCK, researchers have used a protocol involving:

    • Cell harvesting by centrifugation (15 minutes at 5,000×g)

    • Resuspension in buffer containing 50 mM Tris, 50 mM EDTA, pH 8.0

    • Overnight freezing at -20°C

    • Thawing with addition of lysozyme (in 250 mM Tris, pH 8.0)

    Similar principles with modifications for membrane proteins could be applied for protein extraction.

  • Quality control: Use multiple methods to verify protein integrity, including functional assays under different pressure conditions.

How does the RecD function relate to recombinant protein expression in P. profundum?

The RecD function has been identified as essential for high-pressure growth in P. profundum SS9 . RecD, along with RecB and RecC (exonuclease V), plays a major role in homologous recombination pathways . This has significant implications for recombinant protein expression:

  • Plasmid stability: P. profundum mutants deficient in RecD function show decreased plasmid stability , which could affect expression vector maintenance and therefore recombinant protein yields.

  • Homologous recombination: The RecBCD complex possesses ATP-dependent functions including exonuclease and helicase activities important for DNA recombination . These functions may influence the integration and stability of recombinant constructs.

  • Pressure adaptation: RecD function is required for normal growth and cell morphology at high pressure , suggesting that proper DNA maintenance machinery is essential for pressure adaptation. This may indirectly affect the expression of all proteins, including recombinant frdC.

  • Expression strategy considerations: When designing expression strategies for high-pressure cultivation, researchers should ensure that recombination machinery remains functional to maintain plasmid stability and proper cellular function.

What analytical techniques are most appropriate for characterizing the pressure adaptations of recombinant frdC?

Several analytical approaches can be employed to characterize pressure adaptations in recombinant frdC:

  • Comparative enzymatic assays: Measure fumarate reductase activity at different pressures using pressure-resistant spectrophotometric cuvettes.

  • Differential scanning calorimetry: Compare thermal stability of frdC from pressure-adapted and non-adapted strains under different pressure conditions.

  • Circular dichroism spectroscopy: Analyze secondary structure changes under pressure.

  • FTIR spectroscopy: Diffuse reflectance infrared Fourier transform (DRIFT) spectroscopy has been used to study cellular responses to stress in bacteria and could be adapted to study purified recombinant proteins under pressure.

  • Hydrogen-deuterium exchange mass spectrometry: Analyze protein dynamics and conformational flexibility differences between pressure-adapted and non-adapted variants.

  • Structural biology approaches: Where possible, determine high-resolution structures using X-ray crystallography or cryo-EM to identify structural adaptations that enable function under pressure.

How should experiments be designed to accurately compare frdC function between different P. profundum strains?

When comparing frdC function between strains with different pressure adaptations (e.g., SS9 vs. 3TCK), consider these experimental design principles:

  • Standardized expression systems: Use identical expression vectors and promoters across strains to minimize variation from expression systems rather than the protein itself.

  • Growth condition normalization: Cultivate each strain at its optimal pressure and temperature, but also include crossover conditions where both strains are grown under identical conditions for direct comparison.

  • Multiple biological replicates: Due to potential variability in pressure responses, include at least three biological replicates per condition.

  • Time-course analyses: Monitor protein expression and function over time, as pressure effects may manifest differently during various growth phases.

  • Control proteins: Include well-characterized control proteins that are not pressure-sensitive to validate your experimental system.

What control experiments are essential when studying recombinant frdC under high pressure conditions?

Essential controls for high-pressure experiments with recombinant frdC include:

  • Empty vector controls: Cells carrying the expression vector without the frdC gene to account for vector-related effects.

  • Pressure-naive protein controls: Include a recombinant protein known to have no pressure adaptation to differentiate general pressure effects from specific adaptations.

  • Native vs. recombinant comparison: Compare the function of native frdC with recombinant versions to ensure proper folding and functionality.

  • Non-piezophilic homolog: Express frdC from a non-pressure-adapted bacterium (e.g., E. coli) in the same system to highlight pressure-specific adaptations.

  • Temperature controls: Since piezophilic bacteria are often also psychrophilic, include temperature controls to distinguish pressure from temperature effects.

How can genomic approaches help identify regulatory elements affecting recombinant frdC expression?

Current genomic technologies offer powerful approaches to understand frdC regulation:

  • Comparative genomics: Analyze the genomic context of frdC across P. profundum strains to identify conserved regulatory elements. The available genome sequences for strains like SS9 and 3TCK facilitate such comparisons .

  • Transcriptome analysis: RNA-seq under various pressure conditions can identify pressure-responsive promoters suitable for recombinant expression.

  • ChIP-seq: Identify transcription factors and regulatory proteins that interact with the frdC promoter region.

  • Promoter dissection: Systematic deletion analysis of upstream regions can identify minimal promoter elements required for pressure-responsive expression, similar to the promoter analysis techniques described for other P. profundum genes .

  • SNP analysis: Single nucleotide polymorphisms between strain variants may indicate positions under selection pressure that affect gene regulation, similar to the SNP validation analysis described for M. bovis .

How can issues with plasmid stability in P. profundum be addressed when expressing recombinant frdC?

Plasmid stability is a critical concern when working with P. profundum, especially since RecD mutants show decreased plasmid stability . To address this:

  • Selection pressure: Maintain continuous antibiotic selection using appropriate concentrations (e.g., chloramphenicol at 200 μg/ml or streptomycin at 150 μg/ml) .

  • Specialized vectors: Use vectors specifically designed for marine bacteria that show enhanced stability in Photobacterium species.

  • Genomic integration: Consider integrating the frdC gene into the chromosome rather than maintaining it on a plasmid, especially for long-term experiments.

  • Regular verification: Check plasmid presence and integrity regularly during cultivation, especially after pressure changes.

  • Recombination system consideration: In strains with RecD mutations, complementation with functional RecD may improve plasmid stability, as demonstrated in previous studies .

What strategies can overcome poor expression or improper folding of recombinant frdC?

If facing challenges with expression or folding:

  • Codon optimization: Optimize the coding sequence for P. profundum codon usage.

  • Expression temperature: Lower the expression temperature to slow folding and improve proper membrane insertion.

  • Chaperone co-expression: Co-express molecular chaperones that assist in proper folding of membrane proteins.

  • Fusion tags: Use solubility-enhancing fusion partners, but be aware they may affect membrane insertion.

  • Membrane composition modification: Supplement growth media with specific lipids that match the native membrane environment of P. profundum.

  • Pressure-cycling: For pressure-adapted proteins, cyclic pressure exposure during expression may improve folding by mimicking natural conditions.

How can contamination issues be identified and mitigated when working with marine bacterial cultures?

Contamination detection and prevention is crucial:

  • Molecular verification: Regularly verify culture purity using species-specific PCR. The search results mention several PCR primers specific for P. profundum genes that could be adapted for identification .

  • Selective media: Use marine-specific media with salt concentrations that inhibit common laboratory contaminants.

  • Microscopic examination: Regularly check culture morphology as P. profundum has distinctive cellular characteristics.

  • Sequence verification: For recombinant constructs, sequence verification is essential to confirm the absence of mutations, following approaches similar to those described for genome sequencing validation .

  • Aseptic technique: Maintain rigorous aseptic technique, especially when working with pressure vessels where contamination may be harder to detect.

What novel approaches might enhance our understanding of pressure adaptation in membrane proteins like frdC?

Emerging technologies and approaches offer new avenues for research:

  • Cryo-EM under pressure: Developing technologies for structural analysis under pressure conditions could reveal dynamic conformational changes.

  • Single-molecule studies: Apply single-molecule techniques to study individual protein behavior under different pressure regimes.

  • Synthetic biology approaches: Design minimal synthetic membrane systems with defined composition to study lipid-protein interactions under pressure.

  • Computational predictions: Leverage machine learning and molecular dynamics to predict pressure adaptations in protein sequences.

  • Systems biology integration: Combine proteomic, transcriptomic, and metabolomic data to understand how frdC functions within the entire respiratory network under pressure.

How might understanding pressure adaptation in frdC contribute to biotechnological applications?

Research on pressure-adapted proteins has significant biotechnological potential:

  • Enzyme stability engineering: Principles of pressure adaptation could inform the design of industrially relevant enzymes with enhanced stability.

  • Biocatalysis under pressure: Pressure-adapted enzymes may enable new bioprocesses where high pressure is advantageous.

  • Membrane protein expression systems: Insights from pressure-adapted membrane proteins could improve expression systems for difficult-to-express membrane proteins of medical relevance.

  • Biofuel applications: Enhanced understanding of respiratory chain components like fumarate reductase could improve biofuel production processes.

  • Biosensors: Pressure-responsive proteins could be developed into sensors for high-pressure environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.