Recombinant Photobacterium profundum Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
frdD; PBPRA3381; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
frdD
Target Protein Sequence
MVNLNPKRSDEPVWWGLFGAGGTWFAMLTPVTILVLGIMVPLGILDADAMSYERVSGFVT SFIGALFTIATLALPMWHAMHRLHHGMHDLKFHTGVVGKIACYATAFLVSALAIIFVFMI
Uniprot No.

Target Background

Function
This protein anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase in Photobacterium profundum?

Fumarate reductase (Frd) in Photobacterium profundum functions as a key enzyme in anaerobic respiration, allowing the bacterium to use fumarate instead of oxygen as a terminal electron acceptor. Similar to other bacteria, P. profundum's Frd catalyzes the reduction of fumarate to succinate, which is particularly important for its adaptation to deep-sea environments where oxygen can be limited. This enzyme is part of the electron transport chain and contributes to energy generation under anaerobic conditions, which is crucial for P. profundum strains that are adapted to high-pressure, low-temperature environments .

How does P. profundum fumarate reductase differ from that of other bacterial species?

P. profundum fumarate reductase likely possesses unique adaptations compared to homologous enzymes in other bacterial species like E. coli or Bacteroides thetaiotaomicron. While the basic catalytic function of converting fumarate to succinate is conserved, P. profundum's enzyme may have structural modifications that optimize its function under high-pressure and low-temperature conditions typical of deep-sea environments. Unlike some bacterial species where Frd may contribute significantly to reactive oxygen species (ROS) production during oxidative stress (as seen in B. thetaiotaomicron), P. profundum's Frd may have evolved different properties related to oxygen sensitivity given its adaptation to varying oceanic conditions .

What expression systems are optimal for producing recombinant P. profundum frdD?

  • Temperature optimization: Expression at lower temperatures (15-20°C) to mimic P. profundum's natural environment and improve proper folding

  • Codon optimization: Adjusting codons for efficient expression in E. coli

  • Co-expression strategies: When studying frdD function, co-expression with other Frd subunits (frdA, frdB, frdC) may be necessary for proper complex formation

  • Membrane protein considerations: Use of E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

The T7 expression system has been successfully used for other fumarate reductase components and offers tight control of expression through IPTG induction .

What purification methods are effective for recombinant P. profundum frdD?

Given that frdD is a membrane protein, the following purification protocol is recommended:

Step 1: Membrane fraction isolation

  • Lyse cells by French press or sonication in buffer containing protease inhibitors

  • Remove cell debris by low-speed centrifugation (10,000 × g, 20 min)

  • Collect membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

Step 2: Membrane protein solubilization

  • Solubilize membranes using a mild detergent (e.g., n-dodecyl-β-D-maltopyranoside or digitonin)

  • Optimize detergent concentration to maintain protein-protein interactions if studying the whole complex

Step 3: Affinity purification

  • Use His-tag or other affinity tags for initial purification

  • Employ gentle washing conditions to preserve native structure

Step 4: Size exclusion chromatography

  • Further purify by gel filtration to separate the intact complex from individual subunits

This approach has been effective for isolating membrane components of similar enzyme complexes from other bacterial species .

How can I verify the correct folding and membrane integration of recombinant frdD?

To verify proper folding and membrane integration of recombinant frdD:

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements characteristic of properly folded membrane proteins

  • Protease accessibility assays: Test susceptibility to proteolytic digestion to confirm membrane topology

  • Complex assembly verification: Use blue native PAGE to determine if frdD can assemble with other Frd subunits

  • Functional assays: Measure quinone binding or electron transfer capacity

  • Reconstitution into liposomes: Assess integration into artificial membrane systems

These methods collectively provide strong evidence for proper structural integrity and membrane integration of the recombinant frdD protein.

How can I measure the enzymatic activity of fumarate reductase containing recombinant frdD?

To measure enzymatic activity of fumarate reductase containing recombinant frdD, employ these methodological approaches:

Method 1: Inverted membrane vesicle assay

  • Prepare inverted membrane vesicles containing the recombinant enzyme by French press

  • Measure succinate:quinone oxidoreductase activity by monitoring quinone reduction spectrophotometrically

  • Alternatively, assess NADH:fumarate reductase activity as a coupled assay

Method 2: Reconstituted enzyme assay

  • Purify all four subunits (FrdA, FrdB, FrdC, FrdD)

  • Reconstitute into liposomes with appropriate lipid composition

  • Measure electron transfer from succinate to artificial electron acceptors

Method 3: Whole-cell assays

  • Express recombinant enzyme in an E. coli frd knockout strain

  • Assess anaerobic growth complementation with fumarate as the terminal electron acceptor

  • Measure fumarate consumption or succinate production by HPLC

Typical activity values for bacterial fumarate reductases range from 0.5-2 μmol/min/mg protein depending on assay conditions .

How is P. profundum fumarate reductase activity affected by pressure?

Given P. profundum's adaptation to deep-sea environments (particularly strain SS9 which has optimal growth at 28 MPa), its fumarate reductase activity is likely pressure-dependent. To investigate this:

  • Use high-pressure bioreactors to measure enzyme activity at pressures ranging from atmospheric (0.1 MPa) to deep-sea levels (up to 70 MPa)

  • Compare activity profiles across different P. profundum strains with varying pressure optima:

    • Strain SS9 (optimal at 28 MPa)

    • Strain 3TCK (optimal at 0.1 MPa)

    • Strain DSJ4 (optimal at 10 MPa)

Expected results table:

Pressure (MPa)Relative Activity (%)
Strain SS9Strain 3TCKStrain DSJ4
0.140-6090-10050-70
1070-8060-7090-100
2890-10030-4070-80
5060-7010-2030-40

The activity patterns would likely correlate with the strains' natural habitat pressures, demonstrating evolutionary adaptation of the enzyme complex .

What is the role of frdD in quinone binding and electron transfer?

The frdD subunit, as one of the membrane anchor components of fumarate reductase, plays a critical role in:

Mutations in key residues of frdD can significantly impact quinone binding affinity and electron transfer rates. The quinone binding site in bacterial fumarate reductases is located approximately 40 Å from the FAD site in frdA, creating an electron transfer pathway through the protein complex .

How can I study the potential role of P. profundum fumarate reductase in reactive oxygen species (ROS) generation?

Unlike some bacterial fumarate reductases that contribute significantly to ROS production (like in B. thetaiotaomicron), P. profundum's enzyme may have different properties. To investigate this:

Method 1: In vitro ROS detection

  • Isolate inverted membrane vesicles containing fumarate reductase

  • Expose to varying oxygen concentrations

  • Measure H₂O₂ production using Amplex Red assay

  • Compare ROS production with and without fumarate supplementation

Method 2: Comparative analysis with other bacterial species

  • Express recombinant P. profundum Frd alongside E. coli and B. thetaiotaomicron Frd in a common host

  • Compare ROS generation under identical conditions

  • Identify structural features that might explain differences in ROS production

Method 3: Mutagenesis studies

  • Create site-directed mutants in frdD at residues predicted to influence electron leakage

  • Assess changes in ROS production

  • Correlate structural changes with functional outcomes

This approach would help determine whether P. profundum's adaptation to its unique ecological niche has resulted in modifications to minimize ROS generation during changes in oxygen availability .

How does temperature affect the stability and function of recombinant P. profundum frdD?

P. profundum strains show adaptation to low temperatures (psychrophilic characteristics), which likely extends to their enzymes. To investigate temperature effects on recombinant frdD:

  • Thermal stability assays:

    • Measure protein unfolding using differential scanning calorimetry

    • Compare stability across temperature ranges (0-30°C)

    • Assess both isolated frdD and the complete Frd complex

  • Activity vs. temperature profiling:

    • Measure enzyme activity at temperatures from 0-25°C

    • Generate Arrhenius plots to determine activation energy

    • Compare with mesophilic homologs from E. coli

  • Structural flexibility analysis:

    • Use hydrogen-deuterium exchange mass spectrometry to assess protein dynamics

    • Compare flexibility parameters across temperature ranges

Expected temperature-activity relationship:

Temperature (°C)Relative Activity (%)
P. profundum FrdE. coli Frd
020-305-10
540-5015-20
1060-7030-40
1580-9050-60
2090-10070-80
2570-8090-100
3040-5080-90

This data would reveal adaptation signatures consistent with P. profundum's psychrophilic nature .

What structural features of P. profundum frdD contribute to its function under high pressure?

To elucidate the structural adaptations that enable P. profundum frdD to function under high pressure:

  • Comparative sequence analysis:

    • Align frdD sequences from multiple P. profundum strains with different pressure optima

    • Identify amino acid substitutions that correlate with pressure adaptation

    • Focus on residues affecting membrane integration and protein-protein interactions

  • Molecular dynamics simulations:

    • Model frdD structure at varying pressures (0.1-70 MPa)

    • Analyze conformational changes and protein compressibility

    • Identify pressure-sensing regions within the protein

  • Site-directed mutagenesis:

    • Generate mutants by replacing pressure-adaptive residues with counterparts from non-piezophilic organisms

    • Test functionality under varying pressure conditions

Key features likely include increased flexibility in certain regions, specific amino acid compositions favoring protein-lipid interactions under pressure, and modifications to quaternary structure interfaces that maintain complex integrity at high pressure .

Why might I observe low expression yields of recombinant P. profundum frdD and how can I improve them?

Low expression yields of recombinant P. profundum frdD can result from several factors:

Common issues and solutions:

  • Toxicity to host cells:

    • Use tightly regulated expression systems (e.g., pBAD)

    • Lower induction levels and growth temperature

    • Consider specialized E. coli strains (C41/C43) designed for toxic membrane proteins

  • Codon usage bias:

    • Optimize codons for E. coli expression

    • Use strains with additional tRNAs for rare codons (Rosetta)

  • Protein misfolding/aggregation:

    • Express at lower temperatures (15-20°C)

    • Add chemical chaperones to growth media (e.g., 5% glycerol, 1% glucose)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Improper membrane integration:

    • Ensure signal sequences are intact

    • Consider fusion with well-expressed membrane proteins

    • Optimize membrane composition by supplementing specific phospholipids

  • Degradation:

    • Use protease-deficient strains

    • Add protease inhibitors during induction

    • Harvest cells at optimal time points before degradation occurs

Implementation of these strategies has been shown to increase yields of difficult membrane proteins by 3-10 fold .

How can I distinguish between native and recombinant P. profundum fumarate reductase activity?

To distinguish between native and recombinant fumarate reductase activity:

  • Genetic tagging strategies:

    • Add epitope tags (His, FLAG) to recombinant frdD

    • Use tag-specific antibodies for immunoprecipitation before activity assays

    • Perform Western blots to quantify recombinant vs. native protein

  • Selective inhibition:

    • Identify inhibitors with differential effects on native vs. recombinant enzyme

    • Design recombinant enzyme with altered inhibitor sensitivity

  • Species-specific activity differences:

    • Compare kinetic parameters (Km, Vmax) that may differ between native and recombinant enzymes

    • Utilize differences in substrate specificity if present

  • Expression in heterologous hosts:

    • Express in an E. coli strain lacking endogenous fumarate reductase

    • Use the ΔfrdABCD knockout strain to eliminate background activity

These approaches ensure that measured activity can be confidently attributed to the recombinant enzyme rather than host cell background .

What are the critical factors for maintaining stability of P. profundum fumarate reductase during purification?

Maintaining stability of P. profundum fumarate reductase during purification requires attention to several critical factors:

  • Buffer composition:

    • Use buffers that mimic the native environment (high salt concentration ~3% NaCl)

    • Maintain pH between 7.0-7.5

    • Include stabilizing agents such as glycerol (10-20%)

  • Detergent selection:

    • Test multiple detergents (DDM, LMNG, digitonin)

    • Use the minimum concentration needed for solubilization

    • Consider detergent exchange during purification to more stable options

  • Temperature control:

    • Perform all purification steps at 4°C

    • For long-term storage, consider flash-freezing in liquid nitrogen with cryoprotectants

  • Oxidative damage prevention:

    • Include reducing agents (DTT or TCEP, 1-5 mM)

    • Maintain anaerobic conditions when possible

    • Add antioxidants like ascorbic acid

  • Cofactor retention:

    • Supplement buffers with FAD (10 μM) to prevent loss from the flavoprotein subunit

    • Include divalent cations (Mg²⁺, 5 mM) for structural stability

Following these guidelines can significantly improve enzyme stability and retention of activity, with properly stabilized preparations maintaining >80% activity for up to 2 weeks at 4°C .

How can recombinant P. profundum fumarate reductase serve as a model for studying enzyme adaptation to extreme environments?

Recombinant P. profundum fumarate reductase offers an excellent model system for studying enzyme adaptation to extreme environments:

  • Comparative studies across strains:

    • Compare enzyme properties from strains adapted to different pressures and temperatures

    • Identify molecular signatures of adaptation

    • Correlate genetic changes with functional outcomes

  • Structure-function relationships:

    • Determine crystal structures under varying pressure conditions

    • Identify regions that undergo conformational changes

    • Map flexibility vs. rigidity domains that enable function in extreme conditions

  • Directed evolution approaches:

    • Subject enzymes to laboratory evolution under different selection pressures

    • Track molecular changes that confer improved function

    • Test evolutionary hypotheses about adaptation pathways

  • Biotechnological applications:

    • Apply insights to engineer enzymes with improved stability for industrial processes

    • Develop biocatalysts that function under non-standard conditions

This research not only advances our understanding of extremophile adaptation but also provides templates for protein engineering and insights into the limits of life in extreme environments .

What insights can P. profundum fumarate reductase provide about electron transport in high-pressure environments?

P. profundum fumarate reductase can reveal fundamental insights about electron transport adaptations to high-pressure environments:

  • Electron transfer kinetics:

    • Measure electron transfer rates under varying pressures

    • Determine if pressure alters the rate-limiting steps in the reaction

    • Compare with homologous enzymes from non-piezophilic organisms

  • Redox potential modulation:

    • Assess how pressure affects the redox potentials of electron carriers

    • Determine if pressure shifts energetic barriers for electron transfer

    • Measure changes in midpoint potentials of Fe-S clusters under pressure

  • Structural adaptations:

    • Identify modifications in electron transfer pathways that accommodate pressure effects

    • Analyze changes in distances between redox centers

    • Examine altered protein dynamics that maintain optimal electron tunneling distances

  • Interaction with membrane components:

    • Study how pressure affects interaction with quinones

    • Determine if lipid composition changes alter electron transfer efficiency

    • Assess pressure effects on proton-coupled electron transfer

This research addresses fundamental questions about bioenergetics under extreme conditions and may reveal novel mechanisms for efficient energy conservation in challenging environments .

How might knowledge of P. profundum fumarate reductase contribute to understanding bacterial adaptation in changing marine environments?

Understanding P. profundum fumarate reductase has broader implications for bacterial adaptation in marine environments:

  • Climate change responses:

    • Investigate how temperature-pressure interactions affect enzyme function

    • Model effects of ocean warming on deep-sea microbial metabolism

    • Assess adaptive capacity of deep-sea bacteria to changing conditions

  • Biogeochemical cycling:

    • Determine contributions to marine carbon and sulfur cycles

    • Assess impacts on organic matter degradation at different ocean depths

    • Model how changes in enzyme function might alter marine nutrient cycles

  • Evolutionary adaptation mechanisms:

    • Compare homologs across marine bacteria from different depths

    • Identify convergent adaptations to similar environmental pressures

    • Develop predictive models for enzyme evolution in response to environmental changes

  • Ecophysiological implications:

    • Link enzyme adaptations to niche differentiation in marine environments

    • Determine how metabolic flexibility contributes to ecological success

    • Assess potential for acclimation versus adaptation in response to environmental change

This research connects molecular mechanisms to ecosystem function and provides insights into how microbial communities might respond to ongoing and future changes in marine environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.