Recombinant Photobacterium profundum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Biological Role

Glycerol-3-phosphate acyltransferase (PlsY) is a membrane-bound enzyme encoded by the plsY gene. Unlike the more common acyl-CoA-dependent acyltransferases, PlsY utilizes acylphosphate as a substrate, a pathway prevalent in bacteria like Streptococcus pneumoniae and Photobacterium profundum . Key functions include:

  • Catalytic activity: Transfers acyl groups to the sn-1 position of glycerol-3-phosphate, forming 1-acyl-sn-glycerol-3-phosphate .

  • Membrane topology: Contains five transmembrane segments with critical cytoplasmic domains for substrate binding and catalysis .

  • Role in extremophiles: Essential for maintaining membrane fluidity under high-pressure conditions, as observed in deep-sea bacteria like P. profundum .

Recombinant Protein Characteristics

The recombinant PlsY from P. profundum (UniProt ID: Q6LV09) is expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
Source organismPhotobacterium profundum
Expression systemEscherichia coli
Amino acid sequence203 residues (Full length: 1–203 aa)
Molecular weight~23 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
ReconstitutionSterile water to 0.1–1.0 mg/mL; glycerol (5–50%) recommended

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate your preferences in the order notes. We will fulfill your request based on available resources.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening the vial, we recommend a brief centrifugation to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development if possible.
Synonyms
plsY; PBPRA0435; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
plsY
Target Protein Sequence
MTPLVLLIIIGAYLLGSISSAVLISRLYRLPDPRDSGSGNPGATNVLRLGGKSAASMVLV CDVLKGMLPVWLSYFLNINPFLLGIIGIAACLGHIYPIFFHFRGGKGVATALGALAPIGW DLSGMLIGTWLLTVFITGYSSLGSLITALAAPLLTWFVKPEYTMAVSMLSCLIVLRHHDN LRRLFEGKETKIWQKISRKAKLK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of PlsY in bacterial phospholipid biosynthesis?

PlsY catalyzes a critical step in the most widely distributed pathway for bacterial membrane phospholipid biosynthesis. Specifically, it transfers the acyl group from acylphosphate to glycerol 3-phosphate, which initiates phosphatidic acid formation . This reaction follows the conversion of acyl-acyl carrier protein to acylphosphate by PlsX . Phosphatidic acid then serves as a precursor for the synthesis of various membrane glycerophospholipids . This pathway is essential for bacterial cell membrane integrity and function, making PlsY a potential target for antimicrobial development.

What is the membrane topology of the Photobacterium profundum PlsY protein?

While the search results don't specifically describe P. profundum PlsY topology, studies on Streptococcus pneumoniae PlsY using the substituted cysteine accessibility method revealed that PlsY has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The protein contains three larger cytoplasmic domains, each with a highly conserved sequence motif that is critical for catalysis . This topology information is essential for understanding the protein's structure-function relationship and for designing experiments targeting specific domains.

How is PlsY classified enzymatically?

PlsY is officially classified as glycerol-3-phosphate acyltransferase (EC 2.3.1.n3) . It has several alternative names including:

  • Acyl-PO4 G3P acyltransferase

  • Acyl-phosphate--glycerol-3-phosphate acyltransferase

  • G3P acyltransferase (GPAT)

What techniques can be used to purify active PlsY?

Purifying PlsY presents significant challenges due to its nature as an integral membrane protein. Most biochemical studies historically used crude membrane preparations or intact cells due to difficulties in solubilizing the protein without causing inactivation . A breakthrough method was developed using 6-cyclohexyl-1-hexyl-β-d-maltoside as a detergent to successfully solubilize and purify recombinant PlsC (a related acyltransferase) from Shewanella livingstonensis Ac10 in its active form . For recombinant P. profundum PlsY specifically, the protein can be expressed with appropriate tags, purified using affinity chromatography, and stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Researchers should avoid repeated freezing and thawing, and working aliquots can be stored at 4°C for up to one week.

How can site-directed mutagenesis help identify critical residues in PlsY?

Site-directed mutagenesis has been instrumental in identifying functionally important residues in PlsY. Studies revealed that each of the three conserved domains contains residues critical for PlsY catalysis :

  • Motif 1: Contains essential serine and arginine residues

  • Motif 2: Has characteristics of a phosphate-binding loop; mutations of conserved glycines to alanines resulted in a Km defect for glycerol 3-phosphate binding

  • Motif 3: Contains conserved histidine and asparagine important for activity, and a glutamate critical to the structural integrity of PlsY

To conduct similar studies, researchers should:

  • Identify conserved residues through sequence alignment

  • Generate mutants using standard mutagenesis protocols

  • Express and purify the mutant proteins

  • Assess activity changes using enzymatic assays

  • Analyze kinetic parameters to determine specific effects on substrate binding or catalysis

What methods are effective for studying PlsY enzyme kinetics?

When studying PlsY enzyme kinetics, researchers should consider:

  • Substrate preparation: Both acylphosphate and glycerol-3-phosphate substrates must be prepared or obtained in pure form

  • Activity assays: Monitoring the formation of phosphatidic acid or the disappearance of substrates

  • Kinetic analysis: Determining Km, Vmax, and kcat values through Michaelis-Menten kinetics

  • Inhibition studies: PlsY is noncompetitively inhibited by palmitoyl-CoA , which provides insights into regulatory mechanisms

For accurate kinetic analysis, researchers must ensure that the enzyme remains stable and active throughout the assay period, which may require optimization of buffer conditions and detergent concentrations.

Why is P. profundum SS9 a valuable model organism for studying pressure adaptation?

P. profundum SS9 is particularly valuable for studying piezophily (adaptation to high pressure) for several reasons:

  • It grows optimally at 28 MPa and 15°C, but can grow under a wide range of pressures including atmospheric pressure

  • Its ability to grow at atmospheric pressure allows for both easy genetic manipulation and culture

  • It has a well-characterized genome consisting of two chromosomes and an 80 kb plasmid

  • It demonstrates clear differential protein expression patterns between high and low pressure conditions

These characteristics make P. profundum SS9 an ideal organism for investigating pressure-adapted enzymes like PlsY and understanding how these enzymes function differently under varying pressure conditions.

What protocols are used for culturing P. profundum under different pressure conditions?

Based on the search results, P. profundum can be cultured using the following protocol :

  • Media preparation:

    • Use marine broth (28 g/liter 2216 medium; Difco Laboratories)

    • Supplement with 20 mM glucose and 100 mM HEPES buffer (pH 7.5)

    • For some experiments, 75% strength 2216 Marine Medium is used

  • Culture conditions:

    • Temperature: 15-17°C (optimal)

    • For atmospheric pressure (0.1 MPa): Standard culture vessels

    • For high pressure (28 MPa): Seal cultures in heat-sealable plastic bulbs or Pasteur pipettes with no gas space

    • Place sealed vessels in water-cooled pressure vessels

  • Growth monitoring:

    • Measure optical density at 600 nm

    • Typical growth to stationary phase under high pressure conditions takes approximately 5 days

  • Harvest procedure:

    • Centrifuge at 800×g for 10 minutes

    • Snap-freeze cell pellets and store at -80°C for later analysis

This methodology enables comparative studies of enzyme function and expression under different pressure conditions.

How does P. profundum adapt to different pressure environments at the proteome level?

P. profundum demonstrates significant proteome-level adaptations to different pressure environments:

  • Differential protein expression:

    • Proteins involved in the glycolysis/gluconeogenesis pathway are up-regulated at high pressure

    • Several proteins involved in oxidative phosphorylation are up-regulated at atmospheric pressure

  • Physiological adaptations:

    • Different hydrostatic pressures represent distinct ecosystems with their own particular nutrient limitations and abundances

    • The expression of proteins involved in nutrient transport or assimilation appears to be directly regulated by pressure

These adaptations suggest that P. profundum employs different metabolic strategies under varying pressure conditions, which may involve changes in enzyme activity and regulation, including acyltransferases like PlsY.

How do mutations in PlsY affect substrate specificity and enzyme kinetics?

Mutations in PlsY can significantly alter its substrate specificity and kinetic properties:

  • Glycerol-3-phosphate binding:

    • Mutations of conserved glycines in motif 2 to alanines resulted in a Km defect for glycerol 3-phosphate binding

    • This indicates motif 2 corresponds to the glycerol 3-phosphate binding site

  • Acyl chain preferences:

    • Some PlsC family acyltransferases (related to PlsY) show substrate preference for acyl donors with polyunsaturated fatty acyl groups, such as eicosapentaenoyl groups

    • Similar specificity studies could be performed on P. profundum PlsY to determine if pressure adaptation affects acyl chain preferences

  • Inhibition properties:

    • PlsY is noncompetitively inhibited by palmitoyl-CoA

    • The inhibition constant and mechanism may differ in pressure-adapted variants

These structure-function relationships provide insights into how PlsY has adapted to function under high-pressure conditions in P. profundum.

What role does PlsY play in bacterial adaptation to high pressure environments?

While the search results don't directly address PlsY's role in pressure adaptation, several lines of evidence suggest its importance:

  • Membrane composition changes:

    • Bacteria adapt to high pressure by modifying their membrane composition

    • As a key enzyme in phospholipid biosynthesis, PlsY likely contributes to these adaptations

  • Differential protein expression:

    • P. profundum shows different metabolic patterns under varying pressure conditions

    • PlsY activity and regulation may be modulated to accommodate these metabolic shifts

  • Structural adaptations:

    • Pressure can affect protein conformation and activity

    • PlsY from piezophilic bacteria like P. profundum may have structural features that maintain optimal activity under high pressure

Understanding these adaptations could provide insights into bacterial survival strategies in extreme environments and potentially lead to biotechnological applications.

How can experimental design address the challenges of studying pressure effects on enzyme activity?

When designing experiments to study pressure effects on PlsY activity, researchers should consider:

  • Control variables:

    • Temperature must be carefully controlled, as piezophilic organisms often have specific temperature requirements (P. profundum grows optimally at 15°C)

    • Media composition should be identical across pressure conditions to isolate pressure as the sole variable

  • Experimental setup:

    • High-pressure vessels require specialized equipment

    • Samples must be prepared without gas bubbles to ensure uniform pressure distribution

  • Comparative approach:

    • Use of label-free quantitative proteomic analysis can identify differentially expressed proteins

    • Comparing enzyme kinetics at different pressures can reveal pressure-specific adaptations

  • Functional complementation:

    • Testing if P. profundum PlsY can functionally complement PlsY-deficient strains of non-piezophilic bacteria might reveal pressure-specific adaptations

A well-designed experiment might use the following approach:

Hypothesis: P. profundum PlsY maintains higher catalytic efficiency under high pressure compared to PlsY from non-piezophilic bacteria.

Control: Activity of PlsY from a non-piezophilic bacterium (e.g., E. coli) at atmospheric pressure.

Independent variable: Hydrostatic pressure (ranging from 0.1 MPa to 30 MPa).

Dependent variable: Enzyme activity (substrate conversion rate).

This experimental design would help determine whether P. profundum PlsY has specific adaptations for function under high pressure.

What potential applications exist for pressure-adapted enzymes like P. profundum PlsY?

Pressure-adapted enzymes from piezophilic organisms have several potential applications:

  • Synthetic biology:

    • Engineering pressure-resistant metabolic pathways for bioproduction

    • Creation of robust cell membranes for extreme condition applications

  • Novel lipid production:

    • PlsY from P. profundum might be used to produce phospholipids with unique properties

    • These lipids could have applications in drug delivery systems or as functional food ingredients

  • Enzyme evolution studies:

    • Understanding how enzymes adapt to extreme conditions provides insights into evolution

    • This knowledge can inform protein engineering strategies for creating enzymes with novel properties

  • Biocatalysis under high pressure:

    • Some reactions proceed more efficiently under high pressure

    • Pressure-adapted enzymes like PlsY could enable new biocatalytic processes under these conditions

The unique properties of pressure-adapted enzymes represent an untapped resource for biotechnology and basic research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.