Recombinant Photobacterium profundum Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Photobacterium profundum MsbA

Recombinant Photobacterium profundum Lipid A export ATP-binding/permease protein MsbA (msbA) is a laboratory-engineered version of the essential ATP-binding cassette (ABC) transporter found in the deep-sea bacterium Photobacterium profundum. This protein facilitates the ATP-dependent translocation of lipid A, a critical component of lipopolysaccharides (LPS), from the cytoplasmic to the periplasmic leaflet of the inner membrane in Gram-negative bacteria . Its recombinant form enables structural and functional studies aimed at understanding bacterial membrane biogenesis and antibiotic resistance mechanisms .

Recombinant Production Details

ParameterDetails
Expression SystemEscherichia coli
TagHis-tag (position determined during production)
Purity>90% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
Sequence LengthFull-length (1-585 amino acids for Photobacterium profundum variant)

Mechanistic Insights from Homologs

While structural data for P. profundum MsbA is limited, studies on homologs (e.g., Escherichia coli, Salmonella typhimurium) reveal:

  • Substrate Binding: A hydrophobic cavity accommodates lipid A acyl chains, while basic residues interact with phosphorylated glucosamines .

  • Conformational Dynamics: Transitions between inward-facing (lipid A entry) and outward-facing (lipid A release) states during ATP hydrolysis .

  • ATPase Activity: Stimulated by lipid A binding (e.g., E. coli MsbA exhibits a V<sub>max</sub> of 37 nmol/min/mg and K<sub>m</sub> of 878 µM for ATP) .

Antibiotic Development

MsbA is a validated target for novel antibiotics due to its essential role in LPS transport . Inhibitors like G907 disrupt ATPase activity or trap MsbA in non-functional conformations . Recombinant P. profundum MsbA enables:

  • High-throughput screening of inhibitors.

  • Structural studies (e.g., cryo-EM, X-ray crystallography) to map drug-binding sites .

Functional Assays

  • ATPase Activity Assays: Measure hydrolysis rates under varying lipid A concentrations .

  • Lipid Transport Studies: Use fluorescence-based or radiolabeled lipid A to quantify flipping efficiency .

Comparative Analysis with Other MsbA Variants

FeatureP. profundum MsbAE. coli MsbASalmonella typhimurium MsbA
UniProt IDQ6LPK6P60752Q9ZEU7
Cryo-EM StructuresNot available2.8–5.3 Å resolution 2.8 Å resolution
ATPase ActivityNot characterized37 nmol/min/mg 6–10 µmol/min/mg
Inhibitor SensitivityUnknownSensitive to G907 Sensitive to TBT1

Challenges and Future Directions

  • Structural Gaps: No high-resolution structures exist for P. profundum MsbA. Homology modeling using E. coli or Salmonella templates is currently necessary .

  • Functional Divergence: Deep-sea adaptations (e.g., high-pressure tolerance) may confer unique biochemical properties requiring further study .

  • Therapeutic Potential: Engineering P. profundum MsbA into drug-discovery pipelines could yield antibiotics active against multidrug-resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msbA; PBPRA2385; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
msbA
Target Protein Sequence
MTQSTEQSTLDTYKRLWPYISFYKAGLSVAVVALIINALGDTLMLSMIKPLLDESFGGLD NIESDFLSMMPYYLVGLMILRGASGFVSTYCLSWVSGKVVMNLRRGLFNHFMKMPVSFFD KESSGALLSRITYDSEQVASATSSALVSMVREGASIIGLMALMFWNSWQLSAILLVIAPV VAFSIRLVSKRFRKISKNMQDAMGSVTSSAEQMLKGHKVVLSYGGQEVEKQRFDSVSNNM RQQTMKLVSAQAIANPVIQVIASFALVVVLVLANSEALRAELTPGTFAVVFGAMFGLMRP LKALTNVTSQFQRGMAACQTLFELMDLEAEEDNGKHKIARVNGDIQVKNVTFTYPTKDTP ALRNVSFDLPAGKTLALVGRSGSGKSTIANLLTRFYDIDSGELILDGREVKDYQLSNLRD QVAVVSQNVHLFNDTIANNIAYASGDSFSRADIEKAAELAYAMDFIKGMPKGLDTMIGEN GVSLSGGQRQRLAIARALLRNAPVLILDEATSALDTESERAIQSALEELQKDRTVLVIAH RLSTIEGADQILVVDDGEIIERGTHGELIKHDGAYAQLHRIQFGD
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MsbA in Photobacterium profundum?

MsbA is an essential ATP-binding cassette (ABC) transporter in gram-negative bacteria that functions as a lipid flippase. It transports lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane, which is critical for the assembly of the outer cell membrane . In P. profundum, which thrives under high pressure environments, MsbA likely plays a crucial role in maintaining membrane integrity and function under these extreme conditions .

How does P. profundum MsbA compare structurally to homologs from other species?

While specific structural data for P. profundum MsbA is limited in available literature, insights can be drawn from studies of homologous proteins. The MsbA from Salmonella typhimurium has been characterized at 2.8 Å resolution, revealing an inward-facing conformation with a large amplitude opening in the transmembrane portal . P. profundum MsbA likely shares core structural features with other bacterial MsbA proteins but may contain unique adaptations that facilitate function under high pressure environments, particularly in regions affecting membrane integration and substrate binding.

What is known about the genomic organization of P. profundum and its implications for MsbA expression?

P. profundum SS9 has a genome consisting of two chromosomes and an 80 kb plasmid . The genomic context of msbA in P. profundum has not been specifically detailed in the provided sources, but in other gram-negative bacteria, msbA is typically essential for viability. Understanding the genomic organization could provide insights into regulatory elements affecting MsbA expression under different pressure conditions.

What are the optimal conditions for culturing P. profundum for MsbA studies?

P. profundum SS9 grows optimally at 28 MPa and 15°C, though it can grow under a wide range of pressures including atmospheric pressure . For laboratory culture, anaerobic conditions at 17°C in marine broth supplemented with 20 mM glucose and 100 mM HEPES buffer (pH 7.5) have been successfully employed . The ability to grow at atmospheric pressure facilitates genetic manipulation while maintaining physiological relevance.

What expression systems are suitable for recombinant P. profundum MsbA production?

Based on existing methodologies for P. profundum proteins, researchers could employ:

  • Homologous expression in P. profundum using conjugal delivery methods similar to those used for recD studies

  • Heterologous expression in E. coli with appropriate modifications to account for codon usage differences

  • Expression systems incorporating stabilizing agents such as facial amphiphiles, which have been successfully used for S. typhimurium MsbA crystallization

What purification strategies are effective for recombinant P. profundum MsbA?

Membrane protein purification techniques applicable to P. profundum MsbA include:

Purification StepMethodConsiderations for P. profundum MsbA
Membrane IsolationDifferential centrifugationMay require optimization for cells grown under pressure
SolubilizationDetergent extractionSelection of detergent critical for maintaining native conformation
Affinity PurificationHis-tag or other affinity tagsTag placement should minimize interference with function
Further PurificationSize exclusion chromatographyImportant for removing aggregates
StabilizationAddition of facial amphiphilesHas proven successful for other MsbA homologs

How does hydrostatic pressure affect the expression and function of MsbA in P. profundum?

Proteomic analysis of P. profundum grown at atmospheric versus high pressure (28 MPa) has identified differentially expressed proteins involved in pressure adaptation . While specific data on MsbA expression changes is not provided in the search results, proteins involved in key metabolic pathways show pressure-dependent regulation. As a membrane transporter, MsbA function may be influenced by pressure-induced changes in membrane fluidity and lipid composition, which would necessitate adaptive responses in protein structure and activity.

What experimental approaches can assess MsbA function under different pressure conditions?

To investigate pressure effects on P. profundum MsbA function, researchers could employ:

  • ATPase activity assays under varying pressure conditions

  • Fluorescence-based lipid flipping assays using specialized high-pressure equipment

  • Complementation studies in pressure-sensitive mutants

  • Structural analyses using techniques like high-pressure X-ray crystallography

  • Proteomic quantification of MsbA expression at different pressures using methods similar to those described for other P. profundum proteins

How might lipid composition changes under pressure influence MsbA activity?

P. profundum alters its membrane composition in response to pressure. These changes likely affect MsbA function in several ways:

  • Altered substrate availability and presentation in the membrane

  • Modified lipid-protein interactions affecting conformational flexibility

  • Changes in membrane fluidity impacting the energetics of lipid translocation

  • Potential regulatory feedback between membrane composition and MsbA activity

What is the proposed mechanism for lipid A transport by MsbA in P. profundum?

Based on studies of MsbA homologs, the transport mechanism likely follows a "trap and flip" model . In this model:

  • Lipid A enters MsbA through a large transmembrane portal in the inward-facing conformation

  • The substrate binds within the transmembrane cavity

  • ATP binding induces conformational changes that flip the lipid toward the periplasmic leaflet

  • ATP hydrolysis and release return the transporter to the inward-facing conformation

The S. typhimurium MsbA structure reveals putative lipid A density both inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices, supporting this model .

What structural adaptations might enable P. profundum MsbA to function under high pressure?

Potential pressure adaptations in P. profundum MsbA could include:

  • Amino acid substitutions that modify protein compressibility

  • Altered hydrophobic core packing to maintain stability under pressure

  • Modified ATP binding pocket characteristics to maintain catalytic efficiency

  • Adaptations in flexible regions involved in conformational changes

  • Specialized interactions with pressure-adapted membrane lipids

How does the ATP hydrolysis cycle of MsbA couple to lipid transport under pressure?

The ATP hydrolysis cycle in ABC transporters involves conformational changes that are potentially sensitive to pressure effects. In P. profundum MsbA, the coupling between ATP hydrolysis and lipid transport may involve:

  • Pressure-resistant nucleotide binding domain interactions

  • Modified communication between the nucleotide binding domains and transmembrane domains

  • Adaptations in the power stroke mechanism that drives conformational changes

  • Altered kinetics of ATP binding, hydrolysis, and product release under pressure

How can structural biology techniques be optimized for studying P. profundum MsbA?

Structural studies of P. profundum MsbA present unique challenges due to its piezophilic nature. Researchers might consider:

  • Crystallization under pressure-mimicking conditions, potentially using stabilizing facial amphiphiles as demonstrated for S. typhimurium MsbA

  • Cryo-electron microscopy to capture different conformational states

  • High-pressure NMR studies of specific domains or the complete protein

  • Molecular dynamics simulations incorporating pressure parameters

  • Comparative modeling based on structures of homologs like the S. typhimurium MsbA

What genetic approaches can elucidate the physiological importance of MsbA in P. profundum?

Several genetic strategies could be employed:

  • Construction of gene disruption mutants using techniques similar to those used for recD studies in P. profundum

  • Complementation analysis using plasmid-based expression systems

  • Site-directed mutagenesis to identify pressure-sensitive residues

  • Construction of chimeric proteins combining domains from piezophilic and non-piezophilic MsbA homologs

  • Gene regulation studies to examine msbA expression under different pressure conditions

How might P. profundum MsbA research contribute to antibiotic development?

MsbA is essential for the viability of most gram-negative pathogens and represents a viable target for new antibiotics . Research on P. profundum MsbA could contribute to this field by:

  • Identifying conserved features across MsbA homologs that could be targeted by broad-spectrum antibiotics

  • Revealing unique structural features that might be exploitable for selective inhibition

  • Providing insights into pressure-resistant mechanisms that might inform drug design for resistant strains

  • Offering a model system for studying membrane transport under extreme conditions

What controls are essential when designing experiments with recombinant P. profundum MsbA?

Robust experimental design for P. profundum MsbA studies should include:

  • Comparison with wild-type P. profundum to validate recombinant protein behavior

  • Inclusion of non-piezophilic MsbA homologs as comparative controls

  • Pressure gradient experiments to establish dose-response relationships

  • ATPase-deficient mutants to distinguish between active transport and passive effects

  • Appropriate membrane composition controls that mimic native environments

How can researchers address the technical challenges of high-pressure biochemical assays?

Working with proteins under high pressure presents unique challenges that can be addressed through:

  • Development of specialized high-pressure chambers for activity assays

  • Use of pressure-resistant fluorescent probes for transport studies

  • Implementation of rapid sampling techniques that minimize decompression effects

  • Establishment of appropriate baseline corrections for pressure effects on assay components

  • Integration of computational approaches to extrapolate between experimental pressure points

What statistical approaches are most appropriate for analyzing pressure-dependent MsbA activity data?

Analysis of pressure-dependent effects requires careful statistical consideration:

  • Application of non-linear regression models to capture pressure-response relationships

  • Use of mixed-effects models to account for batch-to-batch variation in membrane preparations

  • Implementation of multivariate analyses to examine interactions between pressure, temperature, and other variables

  • Employment of robust statistical methods resistant to outliers

  • Careful assessment of physiological versus statistical significance when interpreting results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.