Recombinant Photobacterium profundum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Photobacterium profundum Prolipoprotein Diacylglyceryl Transferase (Lgt) is a bacterial enzyme critical for the post-translational modification of lipoproteins. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a foundational step in lipoprotein biosynthesis. This enzyme is essential for bacterial membrane integrity, virulence, and survival under stress conditions . The recombinant form enables detailed biochemical and structural studies, offering insights into bacterial physiology and antibacterial drug development .

Enzymatic Function and Mechanism

Lgt is the first enzyme in the lipoprotein maturation pathway:

  1. Substrate Recognition: Binds prolipoproteins via a conserved lipobox motif ([LVI][ASTVI][GAS]C) .

  2. Catalytic Activity: Transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of cysteine +1 in prolipoproteins .

  3. Essential Residues: Y26, N146, and G154 are indispensable for activity; R143, E151, R239, and E243 enhance catalytic efficiency .

Mechanistically, Lgt operates on the periplasmic leaflet of the inner membrane, leveraging its transmembrane topology to access substrates .

Genomic Context in Photobacterium profundum

The lgt gene is part of the P. profundum SS9 genome, which comprises two chromosomes and one plasmid. Key genomic features :

Genomic ElementSize (bp)Gene CountLgt Localization
Chromosome 14,085,3045,480Locus PBPRA0580 (Gene BA5391)
Chromosome 22,237,943--
Plasmid pPBPR180,033--

The lgt gene is conserved across Gram-negative and Gram-positive bacteria, underscoring its functional importance .

Antibacterial Drug Development

  • Lgt is a validated target for novel antibiotics. Inhibitors of Lgt disrupt outer membrane integrity, sensitizing bacteria to serum killing and antibiotics .

  • Unlike downstream lipoprotein-processing enzymes (e.g., LspA), Lgt inhibition cannot be bypassed by deleting major outer membrane lipoproteins like Lpp .

Bacterial Physiology Studies

  • lgt deletion in Bacillus anthracis reduces TLR2-dependent immune responses and impairs spore germination, linking lipoprotein biosynthesis to virulence .

  • In P. profundum, Lgt’s role in high-pressure adaptation remains under investigation, given the organism’s deep-sea habitat .

Production and Purification

Recombinant P. profundum Lgt is typically produced via heterologous expression in E. coli. Key steps include:

  • Cloning: The lgt gene (residues 1–266) is inserted into expression vectors under inducible promoters .

  • Solubilization: Membrane fractions are treated with detergents to extract active enzyme .

  • Storage: Stabilized in glycerol-containing buffers at -20°C or -80°C to preserve activity .

Comparative Analysis with Homologs

Lgt enzymes share a conserved "Lgt signature motif" across bacterial species. A comparison with E. coli and B. anthracis Lgt highlights functional conservation:

FeatureP. profundum LgtE. coli LgtB. anthracis Lgt
Transmembrane Segments777
Essential ResiduesY26, N146, G154Y26, N146, G154Y26, N146, G154
Role in VirulenceUnder investigationCriticalRequired for spore germination

Future Directions

  • Structural Studies: High-resolution crystallography to map substrate-binding pockets.

  • High-Throughput Screening: Identify Lgt inhibitors with broad-spectrum activity against multidrug-resistant pathogens .

  • Ecological Adaptations: Investigate Lgt’s role in P. profundum’s survival under extreme hydrostatic pressure .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; PBPRA0580; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
lgt
Target Protein Sequence
MSQGFLTFPTIDPVLIQLGPLAIRWYGLMYLVGFLFAMWLANRRADKPNSGWTRDQVSDL LFAGFLGVVLGGRIGYVLFYNFGLFLDNPLYLFQVWTGGMSFHGGLLGVMTAMLWYGHRN KRTFFSVADFIAPLVPFGLGMGRMGNFMNGELWGRVTDMPWAMVFPTGGPFPRHPSQLYE AFLEGFVLLIILNIFIRKPRPAGAVSGLFLIGYGSFRFIIEYFREPDAQLGLFGDWISMG QILSSPMIIFGALLMLWAYKAQPKTA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase and what is its role in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme that initiates the bacterial N-terminal lipid modification pathway. Specifically, it catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoproteins. This post-translational modification is unique to bacteria and is critical for the anchoring of lipoproteins to the bacterial membrane . The pathway was initially outlined as a four-step process, but later research demonstrated that Lgt facilitates the direct transfer of a diacylglyceryl moiety to the conserved cysteine residue rather than requiring separate acylation steps . This lipid modification pathway is particularly significant because the enzymes involved, including Lgt, are essential for viability in Gram-negative bacteria, making them potential targets for antibiotic development .

What is known about the structure of Photobacterium profundum Lgt?

The Photobacterium profundum Lgt protein consists of 266 amino acids with a molecular structure that supports its membrane association and catalytic function. According to available data, the full amino acid sequence of P. profundum Lgt (UniProt ID: Q6LUM2) includes multiple transmembrane segments that facilitate its integration into the bacterial inner membrane . The protein contains regions with high hydrophobicity, consistent with its role in lipid modification processes. Research indicates that contrary to earlier predictions based on sequence analysis suggesting multiple transmembrane domains, experimental evidence points to a peripheral and possibly reversible hydrophobic association with the inner membrane on the cytosolic side . This discrepancy between predicted topology and experimental observations highlights the importance of structural studies for understanding Lgt's functional mechanisms.

How does P. profundum Lgt differ from Lgt in other bacterial species?

While the core function of Lgt is conserved across bacterial species, P. profundum Lgt exhibits specific adaptations that may relate to its deep-sea bacterial origin. Photobacterium profundum is a piezophilic (pressure-loving) bacterium isolated from deep ocean environments, suggesting its enzymes, including Lgt, may possess unique structural and functional adaptations for high-pressure conditions . Unlike some other bacterial species, P. profundum lacks homologs of HMGR (3-Hydroxy-3-methylglutaryl-CoA reductase) , indicating differences in metabolic pathways that may influence lipid modification systems. The amino acid sequence of P. profundum Lgt shows characteristic features of the Lgt family while maintaining species-specific variations that may affect substrate specificity or enzymatic efficiency under its native high-pressure, low-temperature conditions.

What experimental approaches are most effective for expressing and purifying active recombinant P. profundum Lgt?

For optimal expression and purification of recombinant P. profundum Lgt, a comprehensive strategy addressing its membrane-associated nature is essential. Expression in E. coli systems using vectors that provide tight control of expression levels (such as pET or pBAD series) has proven effective for similar membrane-associated enzymes. For purification, a dual approach is recommended:

First, membrane fraction isolation via differential centrifugation, followed by solubilization using mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) that maintain enzyme activity. Research has demonstrated that unlike typical integral membrane proteins, Lgt can be extracted from membranes using water or low ionic strength solutions, as it has a peripheral association with the membrane through hydrophobic interactions rather than transmembrane domains . This unique property allows for alternative extraction methods that may preserve enzymatic activity better than conventional detergent solubilization.

Second, purification via affinity chromatography (typically using His-tag systems), followed by size exclusion chromatography to achieve high purity. Maintaining the enzyme in buffers containing glycerol (25-50%) and reducing agents has been shown to enhance stability . Notably, the soluble extracted enzyme retains kinetic properties similar to the membrane-bound form, though differences in heat stability have been observed . This finding suggests that expression and purification strategies should include stability assessments under various temperature conditions.

How can researchers accurately assess the enzymatic activity of recombinant P. profundum Lgt?

Accurate assessment of P. profundum Lgt activity requires specialized assay systems that can monitor the transfer of diacylglyceryl moieties to substrate peptides. A paper electrophoretic assay system has been developed that provides direct, accurate, and precise measurement of Lgt activity . This method offers advantages over previous radioactive assays by eliminating the need for hazardous materials while providing more reliable quantification.

The assay typically employs synthetic peptide substrates containing the recognition motif for Lgt (such as MKATKSAVGSTLAGCSSHHHHHH), with the critical cysteine residue positioned appropriately . The reaction mixture should contain the purified enzyme, peptide substrate, and phosphatidylglycerol as the diacylglyceryl donor in appropriate buffer conditions that mimic the physiological environment of P. profundum.

For kinetic analysis, researchers should determine Km and Vmax values under varying substrate concentrations, pH conditions, and temperatures to establish optimal reaction parameters. When analyzing substrate selectivity, it's important to note that contrary to earlier assumptions, Lgt has been shown to lack substrate preference based on hydrophobicity of the signal peptide h-region, processing peptides with short hydrophilic h-regions as effectively as those with hydrophobic regions . This finding has significant implications for understanding the range of natural substrates that may be processed by Lgt in vivo.

What is the precise membrane topology of P. profundum Lgt and how does it affect function?

The membrane topology of P. profundum Lgt represents an ongoing research question that challenges previous assumptions. Traditional bioinformatic analyses suggest multiple transmembrane domains, but experimental evidence indicates a peripheral membrane association on the cytosolic side of the inner membrane . This discrepancy highlights the limitations of computational topology predictions for certain membrane-associated proteins.

Research methodologies to resolve this question include:

  • Proteolytic accessibility studies using protease protection assays with inverted membrane vesicles

  • Site-directed fluorescence labeling of cysteine residues introduced at strategic positions

  • Electron paramagnetic resonance spectroscopy of spin-labeled variants

  • Cryo-electron microscopy of the enzyme in membrane environments

The functional implications of Lgt's topology are significant: its peripheral association may facilitate access to both the lipid substrate in the membrane and the protein substrate approaching from the cytosol. The finding that Lgt can be readily extracted from membranes with water or low ionic strength solutions suggests a dynamic interaction with the membrane rather than permanent integration . This property may allow the enzyme to associate with different membrane regions or even function in a partially soluble state, as evidenced by the similar kinetic behavior of soluble and membrane-bound forms of the enzyme .

What are the optimal conditions for assessing substrate specificity of P. profundum Lgt?

To accurately assess the substrate specificity of P. profundum Lgt, researchers should implement a systematic approach that accounts for both lipid and peptide substrate variations. The optimal experimental design includes:

Lipid substrate variations:

  • Testing various phospholipids beyond phosphatidylglycerol (PG) as potential diacylglyceryl donors

  • Examining the effect of fatty acid chain length and saturation in PG molecules

  • Comparing natural PG extracted from P. profundum with synthetic or commercial alternatives

Peptide substrate variations:

  • Synthetic peptides with systematic modifications to the lipobox motif

  • Variations in the hydrophobic region length and composition

  • Introduction of non-native amino acids to probe recognition constraints

Research has shown that unlike previous assumptions, Lgt does not show strong preference based on the hydrophobicity of the signal peptide h-region, processing peptides with hydrophilic h-regions as effectively as those with hydrophobic regions . This finding suggests that substrate recognition is more complex than previously thought and may involve multiple interaction points beyond the canonical lipobox motif.

For quantitative analysis, the paper electrophoretic assay system provides precise measurements of activity across different substrate combinations . Reaction conditions should be optimized to reflect the native environment of P. profundum, including consideration of pressure effects given the organism's piezophilic nature. Control reactions using known Lgt substrates from model organisms serve as important benchmarks for comparative analysis.

How can researchers accurately investigate the kinetic parameters of P. profundum Lgt under various environmental conditions?

Investigating kinetic parameters of P. profundum Lgt requires specialized approaches that account for its unique environmental adaptations as a deep-sea bacterial enzyme. A comprehensive kinetic analysis should include:

Temperature dependence studies:

  • Measure activity across a range of temperatures (4-37°C)

  • Determine activation energy using Arrhenius plots

  • Assess cold adaptation mechanisms compared to mesophilic homologs

Pressure dependence analysis:

  • Utilize high-pressure reactors to measure enzyme activity at pressures ranging from atmospheric to deep-sea conditions (up to 40 MPa)

  • Calculate pressure activation volumes

  • Determine pressure stability profiles

pH and ionic strength effects:

  • Establish pH optimum and stability profiles

  • Measure activity across varying ionic strengths to model marine environment conditions

  • Examine the effect of specific ions (Na+, K+, Mg2+) on enzyme performance

For accurate kinetic parameter determination, initial velocity measurements should be performed under conditions where less than 10% of substrate is consumed. The direct paper electrophoretic assay provides precise measurement of reaction progress . When analyzing solubilized enzyme, it's important to note that while the soluble form maintains similar kinetic behavior to the membrane-bound enzyme, differences in heat stability have been observed . These differences should be accounted for when designing temperature-dependent experiments.

The following table summarizes typical experimental conditions for kinetic analysis of P. profundum Lgt:

ParameterRange to TestTypical Optimal ConditionsNotes
Temperature4-40°C15-25°CCold-adapted properties expected
Pressure0.1-40 MPa10-28 MPaHigh-pressure equipment required
pH5.0-9.07.0-8.0Phosphate or Tris buffers suitable
Ionic strength50-500 mM NaCl200-300 mM NaClMarine environment simulation
Substrate concentration (peptide)1-100 μM10-50 μMBelow solubility limits
Substrate concentration (PG)10-200 μM50-100 μMPresented in micelles or liposomes

What are the most effective approaches for studying the structure-function relationship of P. profundum Lgt?

Elucidating the structure-function relationship of P. profundum Lgt requires a multi-disciplinary approach combining biochemical, biophysical, and computational methods. The most effective research strategy includes:

Structural determination methods:

Functional mapping approaches:

  • Site-directed mutagenesis of conserved residues identified through sequence alignment

  • Creation of chimeric proteins with homologous enzymes from non-piezophilic bacteria

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in substrate binding

  • Cross-linking studies with substrate analogs to identify interaction sites

The key challenge in studying Lgt structure-function relationships is reconciling the discrepancy between predicted transmembrane topology and experimental evidence suggesting peripheral membrane association . This requires careful design of experiments that can distinguish between different topological models and their functional implications.

Based on studies of Lgt from other organisms, researchers should pay particular attention to conserved residues that may form the catalytic site, including those involved in phosphatidylglycerol binding and diacylglyceryl transfer. The full amino acid sequence provided for P. profundum Lgt serves as a starting point for identifying these critical residues through comparative sequence analysis with better-characterized homologs.

How can recombinant P. profundum Lgt be utilized in biotechnological applications for protein engineering?

Recombinant P. profundum Lgt offers unique opportunities for protein engineering applications due to its ability to catalyze site-specific lipid modifications. The enzyme can be employed in several biotechnological contexts:

Membrane protein anchoring systems:

  • Development of recombinant proteins with enhanced membrane association

  • Creation of lipid-modified protein vaccines with improved immunogenicity

  • Engineering of membrane-bound enzymes for biocatalysis applications

Protein stability enhancement:

  • Lipid modification of therapeutic proteins to increase half-life

  • Stabilization of enzymes for industrial applications through lipid anchoring

  • Development of lipid-modified proteins with enhanced thermostability

The unique properties of P. profundum Lgt, including its function under high-pressure conditions and its activity in both membrane-bound and soluble forms , make it particularly valuable for applications requiring unusual reaction conditions. Unlike lipid modification systems from mesophilic bacteria, the P. profundum enzyme may offer enhanced stability and activity at lower temperatures, pressure-modulated activity, and potentially broader substrate tolerance.

For successful application in protein engineering, researchers should focus on optimizing expression systems that maintain enzyme activity while allowing scalable production. The finding that Lgt lacks strong substrate preference based on hydrophobicity suggests it may be amenable to processing a wide range of engineered substrate sequences, expanding its utility in diverse protein modification scenarios.

What role could P. profundum Lgt play in antimicrobial drug development research?

P. profundum Lgt represents a valuable target and tool for antimicrobial drug development based on several key research findings:

As a drug target:

  • The lipoprotein processing pathway is essential for viability in Gram-negative bacteria

  • Lgt has no homologs in mammalian systems, offering selectivity

  • Inhibition of Lgt would disrupt multiple bacterial processes dependent on proper lipoprotein localization

As a research tool:

  • Can be used to study the mechanism of action of compounds targeting the lipoprotein processing pathway

  • Enables screening systems for identifying inhibitors of bacterial lipoprotein modification

  • Provides a model for understanding resistance mechanisms to drugs targeting this pathway

Research approaches for drug development should include structure-based design of inhibitors targeting the active site, high-throughput screening of compound libraries, and rational design of substrate analogs that act as competitive inhibitors. The ability to obtain Lgt in soluble form while maintaining activity is particularly advantageous for drug screening assays, as it simplifies the experimental setup compared to membrane-bound enzyme systems.

The paper electrophoretic assay developed for Lgt activity measurement provides a direct and precise method for evaluating potential inhibitors, offering advantages over more complex assay systems. Researchers should exploit this method for initial screening, followed by validation using whole-cell assays to confirm antibacterial activity and target specificity.

How can comparison studies between P. profundum Lgt and homologs from other bacterial species inform evolutionary adaptation research?

Comparative analysis of P. profundum Lgt with homologs from diverse bacterial species offers unique insights into evolutionary adaptations of essential cellular machinery to extreme environments. This research direction can address fundamental questions about protein evolution under selective pressure:

Adaptation to high-pressure environments:

  • Comparison of structural features between piezophilic and non-piezophilic Lgt homologs

  • Identification of amino acid substitutions that confer pressure resistance

  • Analysis of protein flexibility and compressibility differences

Cold adaptation mechanisms:

  • Examination of active site architecture across temperature ranges

  • Quantification of catalytic efficiency at low temperatures

  • Identification of structural modifications that maintain function in cold environments

The research approach should combine phylogenetic analysis, comparative biochemistry, and structural biology. Studies have shown that bacterial genes are subject to lateral gene transfer events that can obscure evolutionary relationships , making careful sequence analysis essential. Researchers should construct phylogenetic trees based on Lgt sequences from diverse bacterial species, including extremophiles and mesophiles, to identify patterns of convergent evolution versus shared ancestry.

Particularly interesting would be the examination of how P. profundum Lgt maintains similar kinetic properties in both membrane-bound and soluble forms , which may represent an adaptation that provides functional flexibility under varying environmental conditions. This dual functionality contrasts with the behavior of some other bacterial enzymes and warrants investigation from an evolutionary perspective.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.