Recombinant Photobacterium profundum Protein CrcB homolog (crcB)

What is Photobacterium profundum and why is it significant for research?

Photobacterium profundum is a deep-sea gammaproteobacterium belonging to the Vibrionaceae family. It is particularly significant for research because it demonstrates remarkable adaptations to high-pressure environments (piezophilic characteristics) and cold temperatures (psychrophilic characteristics) . The most studied strain, SS9, has optimal growth at 15°C and 28 MPa, making it an excellent model organism for studying deep-sea adaptations . P. profundum has two circular chromosomes, similar to other members of the Vibrionaceae family, including Vibrio cholerae .

How does the CrcB homolog fit into the genomic context of P. profundum?

The crcB gene (PBPRA0103) is located on chromosome I of P. profundum . Genomic analysis of P. profundum shows high genomic diversity within the Photobacterium genus, with only about 25% of genes conserved throughout the genus . P. profundum has undergone considerable genomic evolution, with evidence of horizontal gene transfer, genomic islands, and CRISPR-Cas systems that suggest multiple encounters with foreign DNA . The genomic context of crcB may be particularly relevant for understanding its role in deep-sea adaptation.

What are effective methods for expressing recombinant P. profundum CrcB protein?

For expressing recombinant P. profundum CrcB homolog protein:

• Expression system: Due to the membrane protein nature of CrcB, expression in E. coli using vectors with controllable promoters (like pET system) with a C-terminal His-tag can facilitate purification .

• Protein purification: Given its hydrophobic nature, detergent solubilization (e.g., with n-dodecyl-β-D-maltoside) followed by affinity chromatography is recommended for purification .

What experimental designs are suitable for studying CrcB function under high pressure conditions?

When studying CrcB function under high pressure conditions, consider:

• Block design experiments: Implement block design experiments with carefully timed task and rest periods to account for potential physiological confounds . Pressure experiments should include proper controls at atmospheric pressure.

• Pressure-perturbation studies: As used in cytochrome P450 studies in P. profundum, pressure-perturbation can help analyze the role of protein hydration in ligand binding and conformational transitions .

• Complementation assays: Following the methodology used for other P. profundum proteins, complementation assays using plasmid-based systems in E. coli can help identify functional conservation .

• Growth phenotype analysis: Monitor growth rates at different pressures for wild-type vs. crcB mutants to determine phenotypic effects .

How can transposon mutagenesis be used to study CrcB function in P. profundum?

Transposon mutagenesis has been successfully applied to P. profundum to identify genes involved in pressure and temperature adaptation . For studying CrcB:

• Use mini-Tn10 or mini-Tn5 transposon systems, as previously employed for P. profundum mutagenesis .

• Screen for pressure-sensitive or pressure-enhanced mutants by comparing growth at atmospheric pressure (0.1 MPa) versus high pressure (28 MPa) .

• Confirm genotype-phenotype relationships through complementation analysis using a broad-host-range vector like pFL122 .

How might CrcB contribute to P. profundum's adaptation to high pressure environments?

While specific studies on CrcB's role in pressure adaptation are not directly addressed in the search results, several hypotheses can be formulated:

• Membrane integrity regulation: As a predicted membrane protein, CrcB may influence membrane fluidity or permeability under high pressure conditions, similar to how P. profundum alters fatty acid composition in response to pressure .

• Ion homeostasis: If P. profundum CrcB functions as a fluoride channel like its homologs in other bacteria, it may play a role in maintaining ion homeostasis under high pressure, which could be essential for cellular function in deep-sea environments.

• Stress response integration: CrcB might be part of the stress response network that includes known pressure-responsive genes like htpG, dnaK, dnaJ, and groEL in P. profundum SS9 .

How does CrcB interact with DNA replication machinery in P. profundum?

The search results don't directly address CrcB interactions with DNA replication machinery, but we can draw potential connections:

• P. profundum contains several key DNA replication regulators that have been studied in depth, including DiaA (PBPRA3229) and SeqA (PBPRA1039) . These proteins control the initiation of DNA replication, which is particularly sensitive to pressure conditions.

• Mutant strains with disruptions in DNA replication genes (including FL23 with disruption in diaA and FL28 with disruption in seqA) show altered growth under high pressure .

• CrcB could potentially influence DNA replication indirectly through:

  • Maintaining appropriate intracellular ion concentrations needed for replication enzymes

  • Contributing to membrane properties that affect chromosome-membrane interactions

  • Participating in stress response pathways that regulate replication under pressure

What approaches can be used to analyze potential contradictions in experimental data regarding CrcB function?

When faced with contradictory data regarding CrcB function:

• Contradiction classification: Categorize the contradiction type (self-contradiction, pair contradiction, conditional contradiction) to guide your analysis approach .

• Statement importance assessment: Evaluate the importance of conflicting statements, as more important statements generally lead to better contradiction detection and resolution .

• Document positioning analysis: Consider if contradicting data comes from sources positioned close together or far apart in the literature, as this may affect interpretation .

• Evidence length consideration: Be aware that longer conflicting segments may make contradiction detection more challenging .

• Advanced analytical methods: Consider using Retrieval Augmented Generation (RAG) systems with context validation capabilities to help identify and resolve contradictions in the scientific literature .

How do CrcB homologs from different P. profundum strains compare?

P. profundum has several strains with different optimal growth conditions:

• SS9: optimal growth at 15°C and 28 MPa

• 3TCK: optimal growth at 9°C and 0.1 MPa

• DSJ4: optimal growth at 10°C and 10 MPa

• 1230: another cultured wild-type strain

Comparative genomic analysis of the Photobacterium genus reveals high genomic diversity, with only about 25% of genes conserved throughout the genus . The CrcB homolog from P. profundum strain SS9 has the UniProt accession Q6LVY3 . Comparative analysis of CrcB between these strains could reveal adaptations specific to different pressure environments.

What methods can be used to study protein-protein interactions involving CrcB?

For studying protein-protein interactions involving CrcB:

• Bacterial two-hybrid systems: Particularly useful for membrane proteins, these systems can identify potential interaction partners in vivo.

• Co-immunoprecipitation: Using antibodies against tagged CrcB protein to pull down interaction partners, followed by mass spectrometry identification.

• Crosslinking studies: Chemical crosslinking followed by proteomic analysis can capture transient interactions.

• Fluorescence resonance energy transfer (FRET): Can be used to study interactions in living cells if fluorescent protein fusions of CrcB retain functionality.

• Split-GFP complementation: Particularly effective for membrane proteins like CrcB, where each potential interaction partner is fused to a fragment of GFP.

How can CRISPR-Cas systems be utilized for studying CrcB function in P. profundum?

P. profundum contains CRISPR-Cas systems that could be leveraged for genetic manipulation :

• CRISPR architecture identification: P. profundum SS9 has CRISPR-Cas systems similar to those in Yersinia pestis and Escherichia coli, with arrays containing up to 64 protospacers .

• CRISPR-based gene editing: Design guide RNAs targeting the crcB gene, using the native CRISPR-Cas system or introducing a heterologous system.

• CRISPRi applications: For studying essential genes, CRISPR interference using catalytically inactive Cas9 can be employed to downregulate rather than knock out crcB.

• High-pressure considerations: When applying CRISPR technologies, account for the effects of pressure on transformation efficiency and protein function, potentially requiring optimization for piezophilic conditions.

What are effective strategies for establishing research collaborations to study CrcB in P. profundum?

Based on community-based participatory research (CBPR) principles described in the search results :

• Finding suitable research partners: Take time to identify partners with complementary expertise. As noted in the CBCRP guidance: "Doing collaborative research is a time-consuming, new way of doing research... The decision of who your research partner will be is probably one of the most important decisions you will make" .

• Building multidisciplinary teams: Include researchers with diverse expertise (e.g., microbiologists, structural biologists, biophysicists) to address different aspects of CrcB function .

• Developing equal partnerships: Ensure all team members contribute to identifying research questions, developing research plans, conducting research, interpreting results, and disseminating findings .

• Conflict resolution planning: "Make plans now, while the partnership is in its beginning stages, about how you will deal with differences of opinions. Many funded partnerships have both informal and formal agreements about handling differences" .

What data should be included in a comprehensive research report on CrcB function?

A comprehensive research report on CrcB function should include:

• Sequence and structural information:

  • Complete amino acid sequence: MSQFTLLGFIALGGAFGACSRYLISELCVVLLGRGFPYGTLTVNVIGSLLMGILMSSLNQGLIEAGPWRPIIGLGFLGALTTFSTFSMDNVILMQHGEFIKAGLNILLNVALSITACFIGYQLMMKS

  • Predicted membrane topology and structural features

  • Comparison with CrcB homologs from other organisms

• Experimental conditions table:

• Genotype-phenotype correlations: Similar to the analysis performed for other P. profundum genes like diaA and seqA, documenting phenotypic changes associated with crcB mutations .

• Multi-omics data integration: Transcriptomic, proteomic, and metabolomic data to provide a comprehensive view of CrcB's role in cellular physiology.

How can findings on P. profundum CrcB inform broader understanding of deep-sea microbial adaptations?

Research on P. profundum CrcB can inform broader understanding of deep-sea adaptations through:

• Comparative genomics approach: As demonstrated in the Photobacterium genus analysis, comparing CrcB across piezophilic and non-piezophilic species can reveal adaptation patterns .

• Evolutionary analysis: Investigating whether CrcB shows signatures of selection in deep-sea bacteria compared to shallow-water relatives.

• Functional conservation testing: Using complementation studies in heterologous hosts to determine if CrcB function is conserved across pressure gradients, similar to approaches used for studying DiaA and SeqA proteins .

• Systems biology integration: Placing CrcB within the broader context of known pressure-responsive pathways in P. profundum, including stress response genes (htpG, dnaK, dnaJ, groEL) and membrane adaptation mechanisms .