Recombinant Photobacterium profundum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Biological Role

Undecaprenyl-diphosphatase (UppP) (EC 3.6.1.27) catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for synthesizing peptidoglycan and other cell wall components . This reaction is pivotal for recycling UP, allowing bacteria to resist antibiotics like bacitracin, which sequesters UPP .

In Photobacterium profundum, a piezophilic and psychrophilic marine bacterium, UppP activity is adapted to high-pressure, low-temperature environments . Strain SS9, isolated from the Sulu Sea, expresses UppP optimally at 15°C and 28 MPa, reflecting its deep-sea habitat .

Active Site and Catalytic Mechanism

  • Conserved Motifs: UppP contains two key motifs: (E/Q)XXXE and PGXSRSXXT, along with a histidine residue, forming a periplasmic active site .

  • Cation Dependence: Activity is enhanced by divalent cations (e.g., Ca²+), which stabilize the transition state during UPP dephosphorylation .

  • Membrane Localization: As an integral membrane protein, UppP spans the inner bacterial membrane, with structural homology to E. coli UppP (PDB: 5OON, 6CB2) .

Expression and Purification

  • Host System: Expressed in E. coli with N-terminal His-tags or untagged configurations .

  • Purity: >85–90% by SDS-PAGE .

  • Storage: Lyophilized or in Tris-based buffer with 50% glycerol at -20°C/-80°C .

Antibiotic Resistance Studies

UppP confers bacitracin resistance by maintaining UP pools, making it a target for novel antibiotic development .

Extremophile Adaptations

Studies on P. profundum UppP explore how enzyme stability and activity are maintained under high hydrostatic pressure, informing biotechnological applications .

Experimental Considerations

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol to prevent aggregation .

  • Activity Assays: Measured via phosphate release from UPP using colorimetric methods .

Future Directions

Current research focuses on:

  • Engineering thermostable UppP variants for industrial use.

  • Developing UppP inhibitors as next-generation antibiotics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; PBPRA0438; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
uppP
Target Protein Sequence
MSHFEAFMLALIQGLTEFLPVSSSAHLILPSEILGWPDQGLAFDVAVHVGTLAAVILYFR KEVVTLLSAWITSIFKGKHTAESKLTWMIALATIPACIFGLFMKDFIELYLRSAWVIATT TIIFAILLWWVDKHSEHKFDEYQTGWKRALFIGLAQAAAIIPGTSRSGATMTAALYLGFT REAAARFSFLMSIPIIVLAGSYLGLKLVTSGVPIDFSALSIGIAVSFISAYACIHAFLKL VTRVGMMPFVIYRLVLGFGLIAFLLSK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biological significance?

Undecaprenyl-diphosphatase (uppP), also known as Undecaprenyl pyrophosphate phosphatase (UppP), is an integral membrane protein that plays a critical role in bacterial cell wall synthesis. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in the bacterial cell wall synthesis pathway . This reaction is crucial because undecaprenyl phosphate (C55P) acts as a glycan lipid carrier for the synthesis of repeating glycan structures such as peptidoglycans, lipopolysaccharides, teichoic acids, and capsular polysaccharides in bacterial cell walls .

The significance of uppP extends beyond basic metabolism. The enzyme is also known as Bacitracin resistance protein, indicating its role in antibiotic resistance mechanisms . In Photobacterium profundum, a marine bacterium capable of growth at low temperatures and high hydrostatic pressure, uppP may have specialized adaptations that enable cell wall synthesis under extreme conditions .

What are the structural characteristics of P. profundum UppP?

P. profundum UppP is a membrane-bound enzyme with a specific amino acid sequence and structural motifs essential for its function. The full-length protein consists of 267 amino acids with a sequence that begins with MSHFEAFMLALIQGLTEFLPVS and continues through to VGMMPFVIYRLVLGFGLIAFLLSK .

The enzyme contains two consensus regions that are critical for its function:

  • An (E/Q)XXXE motif

  • A PGXSRSXXT motif

These motifs, along with a conserved histidine residue, form the active site of the enzyme. Structural studies suggest that the active site is oriented toward the periplasmic side of the plasma membrane, indicating that the enzyme's biological function occurs on the outer side of the plasma membrane .

The protein's hydrophobic nature necessitates careful handling, as it requires detergents for solubilization and purification. When expressed recombinantly, it is typically stored in a Tris-based buffer with 50% glycerol to maintain stability .

How does the enzymatic mechanism of UppP function?

The catalytic mechanism of UppP involves several key amino acid residues that have been identified through site-directed mutagenesis and computational modeling. The enzyme hydrolyzes undecaprenyl pyrophosphate to undecaprenyl phosphate and releases inorganic phosphate in a magnesium-dependent reaction .

Research has revealed that the active site contains specific residues critical for substrate binding and catalysis:

  • Glu-17 and Glu-21 within the (E/Q)XXXE motif interact with the pyrophosphate moiety of the substrate through a magnesium ion

  • Arg-174 in the PGXSRSXXT motif establishes hydrogen bonds with the OH group of the pyrophosphate moiety

  • His-30, a conserved residue, is positioned in close proximity to the pyrophosphate moiety and is essential for activity

Mutational studies have demonstrated the importance of these residues:

  • E17A mutation resulted in a ~5-fold decrease in kcat values and a ~4-5-fold increase in Km for farnesyl pyrophosphate (Fpp, a substrate analog)

  • E21A mutation caused a ~5-fold decrease in kcat values

  • The double mutation E17A/E21A completely eliminated enzyme activity

  • R174A and H30A mutations severely impaired enzyme activity

These findings suggest that the active site architecture and the coordination of these amino acids are essential for the phosphatase activity of UppP.

What expression systems and purification strategies are optimal for recombinant P. profundum UppP?

Recombinant expression of integral membrane proteins like P. profundum UppP presents significant challenges that require specialized approaches. Based on the literature, successful expression and purification strategies include:

Expression System:
The use of E. coli C41(DE3) strain has proven effective for UppP expression. This strain is particularly suitable for potentially toxic membrane proteins. The expression vector typically includes a bacteriorhodopsin fusion tag (Hmbop1/D94N) at the N-terminus to facilitate expression and purification .

Expression Protocol:

  • Transform the expression vector harboring the Hmbop1/D94N-uppP gene into E. coli C41(DE3)

  • Grow transformed cells at 37°C in LB medium containing 100 mg/ml ampicillin

  • Induce expression when A600 reaches approximately 0.9 with 0.5 mM isopropyl β-d-thiogalactoside

  • Add 5-10 mM all-trans-retinal during induction

  • Continue induction for 5 hours at 37°C

Purification Strategy:

  • Harvest cells and resuspend in buffer containing 50 mM Tris, pH 7.5, 500 mM NaCl

  • Disrupt cells using a cell disruption system

  • Collect membrane fraction by ultracentrifugation (40,000 rpm for 1.5 h)

  • Solubilize the membrane pellet in buffer with 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM)

  • Use affinity chromatography for initial purification

  • Consider size exclusion chromatography for further purification if needed

For long-term storage, the purified protein should be maintained in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided .

What methods are used to assess the enzymatic activity of recombinant UppP?

Enzymatic activity of UppP can be assessed using several complementary approaches:

Phosphate Release Assay:
The most common method uses the Malachite Green assay to quantify inorganic phosphate released during the dephosphorylation reaction:

  • Prepare reaction mixture containing 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl2, 0.02% DDM, undecaprenyl pyrophosphate substrate, and purified UppP

  • Incubate at 37°C for a defined period

  • Quench the reaction by adding Malachite Green reagent

  • Measure absorbance at 650 nm

  • Quantify released phosphate using a phosphate standard curve

For kinetic parameter determination, varying substrate concentrations (e.g., 0.3-57 μM farnesyl pyrophosphate) are used with 20-40 nM UppP. The initial velocity data can be fitted to the Michaelis-Menten equation to determine Km and kcat values .

pH Dependence Studies:
To determine the optimal pH and understand the catalytic mechanism:

  • Conduct assays at various pH values using appropriate buffers:

    • pH 5-6: sodium acetate

    • pH 6.5-8: Hepes

    • pH 9: Tris-HCl

In vivo Complementation:
To verify functional activity in cellular context:

  • Express P. profundum UppP in bacterial strains with temperature-sensitive or deletion mutations in the endogenous uppP gene

  • Assess growth restoration under non-permissive conditions

How can researchers effectively perform site-directed mutagenesis to characterize UppP functional domains?

Site-directed mutagenesis has proven instrumental in characterizing the functional domains and catalytic mechanism of UppP. A comprehensive approach includes:

Target Selection Strategy:

  • Identify conserved residues through sequence alignment of UppP homologs

  • Focus on residues within the consensus motifs: (E/Q)XXXE and PGXSRSXXT

  • Include conserved residues predicted to be near the active site (e.g., His-30)

  • Consider residues implicated in substrate binding by computational modeling

Mutagenesis Protocol:

  • Use PCR-based site-directed mutagenesis with the expression construct as template

  • Design primers to introduce specific mutations (common substitutions include alanine scanning)

  • Confirm mutations by DNA sequencing

  • Transform mutant constructs into the expression host

  • Express and purify mutant proteins using the same protocol as wild-type

Functional Characterization:
For each mutant, assess:

  • Expression levels and protein stability

  • Enzymatic activity using the phosphate release assay

  • Kinetic parameters (Km, kcat, kcat/Km)

  • pH dependence profile

  • Substrate specificity

Data Analysis and Interpretation:
Compare mutant properties with wild-type to determine:

  • Residues essential for catalysis (affecting kcat)

  • Residues involved in substrate binding (affecting Km)

  • Residues contributing to structural integrity (affecting expression/stability)

The E17A/E21A double mutation study demonstrated that both residues are critical for catalysis, as this mutation completely eliminated enzyme activity. Similarly, the R174A mutation in the PGXSRSXXT motif resulted in complete loss of activity, highlighting its essential role .

What techniques are used to study UppP under varying pressure conditions?

Since P. profundum is a piezophilic bacterium that grows optimally at 28 MPa and 15°C , studying UppP under varying pressure conditions requires specialized techniques:

High-Pressure Culture Systems:

  • Pressure vessels capable of maintaining 0.1-50 MPa pressure

  • Temperature-controlled incubation systems suitable for growth at 15°C

  • Specialized media formulations appropriate for P. profundum (e.g., 75% strength 2216 Marine Agar)

Enzyme Activity Under Pressure:

  • High-pressure stopped-flow spectrophotometry for real-time enzyme kinetics

  • Pressure-resistant reaction chambers for enzyme assays

  • Modified Malachite Green assays conducted immediately after pressure treatment

Proteomic Analysis:
Label-free quantitative proteomics can be used to compare UppP expression and modification under different pressure conditions:

  • Culture P. profundum at atmospheric pressure and high pressure (e.g., 28 MPa)

  • Extract and process proteins for mass spectrometry analysis

  • Perform shotgun proteomic analysis

  • Use label-free quantitation to identify differentially expressed proteins

Structural Stability Studies:

  • Circular dichroism spectroscopy under varying pressures

  • Pressure-jump fluorescence spectroscopy

  • Molecular dynamics simulations of UppP under different pressure conditions

These techniques have revealed that P. profundum exhibits significant proteomic changes in response to pressure variations, which may include adaptations in UppP structure or expression that facilitate cell wall synthesis under high pressure conditions .

What are the potential applications of P. profundum UppP in antimicrobial research?

Given the essential role of UppP in bacterial cell wall synthesis, this enzyme presents a promising target for antimicrobial development. Several research directions show particular promise:

Inhibitor Development:

  • Structure-based design of small molecule inhibitors targeting the active site

  • High-throughput screening approaches using purified recombinant UppP

  • Repurposing of existing phosphatase inhibitors

  • Development of transition-state analogs that mimic the pyrophosphate hydrolysis reaction

Resistance Mechanisms:
As UppP is also known as Bacitracin resistance protein , studying its interactions with this antibiotic could provide insights into:

  • Mechanisms of bacitracin resistance

  • Potential for combination therapies that target both UppP and other cell wall synthesis pathways

  • Strategies to overcome resistance through dual-targeting approaches

Broad-Spectrum Applications:
Comparative studies of UppP from different bacterial species could identify:

  • Conserved features for broad-spectrum inhibitor design

  • Species-specific characteristics for selective targeting

  • Structural adaptations in piezophilic bacteria that might be exploited for specialized antimicrobials

Screening Methods:
Development of assays suitable for high-throughput screening:

  • Fluorescent or colorimetric assays for UppP inhibition

  • Whole-cell assays measuring cell wall integrity

  • In silico screening methods based on the active site structure

How does the structure and function of UppP vary across bacterial species?

Comparative analysis of UppP across bacterial species reveals important insights into evolutionary adaptations and functional conservation:

Functional Adaptations:
P. profundum, as a piezophilic bacterium, likely possesses structural adaptations in UppP that enable function under high pressure. These adaptations may include:

  • Enhanced protein stability under pressure

  • Modified substrate binding characteristics

  • Pressure-dependent catalytic efficiency

  • Altered membrane interactions

Comparative Research Approaches:

  • Sequence alignment and phylogenetic analysis of UppP homologs

  • Heterologous expression of UppP from different species

  • Biochemical characterization under varying conditions (temperature, pressure, pH)

  • Cross-complementation studies in bacterial mutants

Future Research Questions:

  • How do piezophilic adaptations in UppP contribute to cell wall synthesis under pressure?

  • Can structural variations in UppP be correlated with bacterial habitat and lifestyle?

  • Are there species-specific inhibitors that can selectively target pathogenic bacteria?

What computational approaches can enhance our understanding of UppP structure and function?

Computational methods offer powerful tools for studying membrane proteins like UppP where experimental structural determination remains challenging:

Structural Modeling:

  • Rosetta membrane ab initio modeling has been successfully applied to predict UppP structure

  • Homology modeling based on structurally characterized homologs

  • Refinement of models through molecular dynamics simulations

  • Integration of experimental data (mutagenesis, spectroscopy) to validate and refine models

Molecular Dynamics Simulations:
MD simulations can provide insights into:

  • Conformational dynamics of UppP in a membrane environment

  • Substrate binding and recognition mechanisms

  • Effects of pressure on protein structure and dynamics

  • Water accessibility to the active site

Substrate Docking and Binding Studies:
Computational docking approaches can predict:

  • Binding modes of undecaprenyl pyrophosphate and other substrates

  • Interactions between key residues and substrate

  • Potential binding sites for inhibitor design

  • Effects of mutations on substrate binding

Machine Learning Applications:
Emerging machine learning approaches can be applied to:

  • Predict effects of mutations on UppP activity

  • Identify novel inhibitors through virtual screening

  • Classify UppP variants based on functional characteristics

  • Integrate diverse experimental data for comprehensive model development

These computational approaches, when combined with experimental validation, offer a powerful strategy for advancing our understanding of UppP structure-function relationships and accelerating the development of targeted inhibitors.

What are the optimal methods for handling the hydrophobic nature of UppP in experimental settings?

The membrane-bound nature of UppP presents significant challenges for in vitro studies. Researchers have developed several strategies to address these challenges:

Detergent Selection:
The choice of detergent is critical for maintaining UppP stability and activity:

  • n-Dodecyl-β-D-maltopyranoside (DDM) at 0.02% has been successfully used in activity assays

  • Consider screening multiple detergents (CHAPS, digitonin, Triton X-100) for optimal solubilization

  • Detergent concentration should be maintained above the critical micelle concentration throughout purification and assays

  • For long-term storage, higher detergent concentrations may be necessary

Buffer Optimization:
For optimal stability and activity:

  • Tris-based buffers with 50% glycerol have been effective for storage

  • Include stabilizing agents such as glycerol or sucrose

  • Maintain pH in the range of 7.0-7.5 for most applications

  • Include 10 mM MgCl2 for activity assays

Membrane Mimetics:
Alternative approaches to detergent solubilization include:

  • Reconstitution into proteoliposomes or nanodiscs for a more native-like environment

  • Amphipols for stabilization of the native structure

  • Lipid cubic phase systems for crystallization attempts

Handling Recommendations:

  • Avoid repeated freezing and thawing; prepare single-use aliquots

  • Store working aliquots at 4°C for up to one week

  • When diluting, maintain detergent concentration above CMC

  • Use low-binding tubes and pipette tips to minimize protein loss

How can researchers effectively integrate structural and functional studies of UppP?

An integrated approach combining structural and functional methodologies provides the most comprehensive understanding of UppP:

Structural Methods:

  • X-ray crystallography (challenging for membrane proteins but potentially feasible with appropriate crystallization conditions)

  • Cryo-electron microscopy for structural determination

  • NMR studies for dynamics and ligand binding

  • Computational modeling validated by experimental data

Functional Assays:

  • Enzyme kinetics using Malachite Green phosphate detection

  • Substrate specificity studies with various lipid pyrophosphates

  • Inhibition studies with potential antimicrobial compounds

  • pH and temperature dependence profiles

Integration Strategies:

  • Structure-guided mutagenesis to test functional hypotheses

  • Activity-guided refinement of structural models

  • Correlation of structural features with kinetic parameters

  • Mapping of inhibitor binding sites using both structural and functional approaches

Emerging Technologies:

  • Hydrogen-deuterium exchange mass spectrometry for probing protein dynamics

  • Single-molecule FRET for conformational analysis

  • Computational simulations incorporating experimental constraints

  • Native mass spectrometry for protein-ligand complexes

By integrating these approaches, researchers can establish clear structure-function relationships that inform both basic understanding of UppP and applied efforts in antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.