Recombinant Photobacterium profundum UPF0208 membrane protein PBPRA2797 (PBPRA2797)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your requirement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PBPRA2797; UPF0208 membrane protein PBPRA2797
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Photobacterium profundum (strain SS9)
Target Names
PBPRA2797
Target Protein Sequence
MTQRTVWQDFQNGQQYMATWPMRKELAAIFPEQRYIKATKFATRVMPAVAVMSVLSQMAF NNYGALPQAMTVALFALTMPLQGLWWLGKRSRTTLPPSLAIWYREIYEKITSEGHAMQPL KKQPRYLELAEVLNRAFKQLDKTSLERWF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is P. profundum significant as a model organism for membrane protein research?

P. profundum SS9 is particularly valuable in membrane protein research because it can grow under a wide range of pressures but exhibits optimal growth at 28 MPa and 15°C . This piezophilic (pressure-loving) characteristic makes it an excellent model for studying pressure adaptation mechanisms. Its ability to also grow at atmospheric pressure allows for easier genetic manipulation and culture compared to obligate piezophiles, making it experimentally tractable . The genome of P. profundum SS9 consists of two chromosomes and an 80 kb plasmid, providing researchers with a complete genetic context for membrane protein studies . Proteomic analyses have demonstrated differential protein expression patterns between high and atmospheric pressure conditions, offering insights into pressure-responsive membrane adaptations.

What expression systems are recommended for recombinant PBPRA2797 production?

Based on current protocols, E. coli is the preferred expression system for recombinant PBPRA2797 production . When expressing this membrane protein, researchers should consider the following methodological approaches:

  • Vector selection: Vectors containing strong inducible promoters (T7, tac) with appropriate affinity tags (His-tag is commonly used for PBPRA2797)

  • Host strain optimization: BL21(DE3) derivatives or C41/C43 strains which are engineered for membrane protein expression

  • Growth conditions: Lower temperatures (16-20°C) after induction to slow protein production and allow proper folding

  • Induction protocol: Gradual induction with lower concentrations of inducer to prevent overwhelming the membrane insertion machinery

It's important to note that membrane protein expression often requires optimization, as the successful overproduction of membrane proteins is linked to avoiding stress responses in the host cell .

What are the recommended storage and handling procedures for recombinant PBPRA2797?

For optimal stability and activity, recombinant PBPRA2797 should be handled according to these guidelines:

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Buffer composition: Optimal stability is achieved in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended; working aliquots can be stored at 4°C for up to one week

What challenges are associated with heterologous expression of PBPRA2797 and other membrane proteins?

Recombinant expression of membrane proteins like PBPRA2797 presents several significant challenges:

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt membrane integrity and cellular homeostasis, triggering stress responses that limit yield

  • Membrane insertion limitations: The cellular machinery for membrane protein insertion (translocon) can become saturated, leading to misfolded protein aggregation

  • Protein folding complexity: The hydrophobic nature of membrane proteins makes proper folding difficult in heterologous systems

  • Post-translational modifications: Differences in lipid composition and modification machinery between the native organism (P. profundum) and expression host (E. coli)

  • Pressure adaptation factors: PBPRA2797 may have evolved structural features optimized for high-pressure environments (28 MPa), which may not fold properly at atmospheric pressure

Recent research indicates that monitoring and managing host cell stress responses is critical. Several genes are either upregulated or downregulated when yields of membrane-inserted protein are poor, providing potential targets for expression optimization .

How does pressure affect protein expression patterns in P. profundum, and what implications might this have for PBPRA2797?

Proteomic analysis of P. profundum growth under different pressure conditions has revealed significant pressure-dependent expression patterns:

  • Metabolic pathway regulation: Proteins involved in glycolysis/gluconeogenesis are up-regulated at high pressure (28 MPa), while several proteins in the oxidative phosphorylation pathway are up-regulated at atmospheric pressure

  • Membrane composition adaptation: Pressure directly regulates the expression of proteins involved in membrane structure and function, likely including membrane proteins like PBPRA2797

  • Transport mechanisms: Proteins involved in nutrient transport or assimilation show pressure-dependent regulation, suggesting membrane transport processes are particularly sensitive to pressure changes

Pressure ConditionUp-regulated PathwaysPotential Impact on PBPRA2797
High Pressure (28 MPa)Glycolysis/GluconeogenesisMay enhance expression or affect conformation of PBPRA2797
Atmospheric PressureOxidative PhosphorylationMay alter membrane environment and PBPRA2797 function

For comprehensive studies of PBPRA2797 function, researchers should consider examining the protein under both pressure conditions, as its native conformation and interactions may be pressure-dependent. A membrane enrichment strategy would be beneficial for more focused studies on how PBPRA2797 responds to pressure changes .

What purification strategies are most effective for obtaining high-quality recombinant PBPRA2797?

Purification of membrane proteins like PBPRA2797 requires specialized approaches:

  • Membrane isolation: Differential centrifugation followed by sucrose gradient ultracentrifugation to isolate membrane fractions

  • Detergent solubilization: Screening multiple detergents is critical, with commonly effective options including:

    • Mild detergents: n-Dodecyl β-D-maltoside (DDM), n-Decyl-β-D-maltopyranoside (DM)

    • Zwitterionic detergents: LDAO, CHAPSO

    • Test detergent panels at various concentrations (0.5-2% w/v)

  • Affinity chromatography: His-tagged PBPRA2797 can be purified using immobilized metal affinity chromatography (IMAC)

    • Nickel or cobalt resins with imidazole gradient elution

    • Critical to include detergent in all buffers

  • Size exclusion chromatography: Final polishing step to separate aggregates and ensure homogeneity

    • Superdex 200 or similar columns in detergent-containing buffer

  • Quality assessment:

    • SDS-PAGE analysis (expected purity >90%)

    • Western blotting

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering for homogeneity assessment

What structural and functional analyses would be most informative for characterizing PBPRA2797?

To comprehensively characterize PBPRA2797, researchers should employ multiple complementary approaches:

How might researchers investigate potential roles of PBPRA2797 in pressure adaptation?

As P. profundum is a model piezophile, PBPRA2797 may play a role in pressure adaptation. To investigate this possibility:

  • Comparative expression analysis:

    • Quantify PBPRA2797 expression at different pressures (atmospheric vs. 28 MPa) using proteomics

    • Compare expression patterns with other known pressure-responsive proteins

  • Gene knockout studies:

    • Generate PBPRA2797 deletion mutants in P. profundum

    • Evaluate growth and membrane characteristics at different pressures

    • Complementation with wild-type and mutant forms to validate phenotypes

  • Membrane physiology assessments:

    • Measure membrane fluidity using fluorescence anisotropy

    • Analyze lipid composition changes in response to PBPRA2797 expression

    • Evaluate membrane permeability under varying pressure conditions

  • Heterologous expression impact:

    • Express PBPRA2797 in pressure-sensitive bacteria

    • Determine if expression confers increased pressure tolerance

    • Analyze membrane characteristics in transformants

These approaches would help determine whether PBPRA2797 actively contributes to pressure adaptation or is regulated as part of a broader cellular response to pressure changes.

What techniques can be used to study membrane insertion and topology of PBPRA2797?

Understanding the membrane topology of PBPRA2797 is crucial for functional characterization. Researchers can employ these methodological approaches:

  • Computational prediction:

    • Hydrophobicity analysis (Kyte-Doolittle plots)

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Topology prediction algorithms (TOPCONS, MEMSAT)

  • Experimental verification:

    • Cysteine accessibility methods:

      • Introduce cysteine residues at predicted loops/turns

      • Test accessibility with membrane-permeable vs. impermeable thiol reagents

    • Fluorescence protease protection (FPP) assay

    • PhoA/LacZ fusion analysis to determine cytoplasmic vs. periplasmic localization

  • Structural probing:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Limited proteolysis combined with mass spectrometry

    • Cross-linking studies with membrane-restricted reagents

Understanding of translocon-mediated membrane insertion mechanisms can provide insight into how PBPRA2797 segments integrate into the membrane.

How can researchers optimize expression conditions to increase functional yield of PBPRA2797?

Maximizing the yield of correctly folded, functional PBPRA2797 requires systematic optimization:

  • Expression construct design:

    • Test multiple fusion tags (His, GST, MBP) and their positions (N- vs. C-terminal)

    • Evaluate codon optimization for expression host

    • Include fusion partners that facilitate membrane insertion

  • Induction parameters:

    • Screen temperature ranges (15-37°C)

    • Test inducer concentration gradients

    • Evaluate different induction durations (4-48h)

  • Media composition:

    • Rich vs. minimal media

    • Inclusion of membrane components or osmolytes

    • Supplementation with specific ions or cofactors

  • Host cell engineering:

    • Co-expression of chaperones or foldases

    • Use of strains with reduced stress responses

    • Strains with altered membrane composition

  • High-throughput screening:

    • GFP-fusion reporter systems to monitor folding

    • Activity-based assays if function is known

    • Stability assays to assess protein quality

These approaches should be systematically tested and can be guided by transcriptomic or proteomic data from P. profundum grown under different pressure conditions .

What analytical techniques are most appropriate for studying PBPRA2797 interactions with lipids and other proteins?

To characterize interactions of PBPRA2797 with membrane components and potential protein partners:

  • Lipid interaction studies:

    • Lipid binding assays (e.g., membrane lipid strips)

    • Liposome flotation assays

    • Differential scanning calorimetry

    • Isothermal titration calorimetry (ITC)

    • Native mass spectrometry with nanodiscs

  • Protein-protein interactions:

    • Co-immunoprecipitation with anti-His antibodies

    • Proximity labeling (BioID, APEX)

    • Cross-linking mass spectrometry

    • Surface plasmon resonance

    • Pull-down assays with candidate interactors

  • In-membrane visualization:

    • Förster resonance energy transfer (FRET)

    • Fluorescence correlation spectroscopy (FCS)

    • Single-particle tracking in reconstituted systems

    • Super-resolution microscopy

  • Functional complex analysis:

    • Blue native PAGE for membrane protein complexes

    • Cryo-electron tomography of membrane structures

    • In-cell protein-fragment complementation assays

These methods could reveal whether PBPRA2797 functions independently or as part of larger protein complexes involved in pressure adaptation or other cellular processes.

How does PBPRA2797 compare to other pressure-responsive membrane proteins?

Comparative analysis of PBPRA2797 with other pressure-responsive proteins reveals important evolutionary patterns:

  • Homology analysis:

    • UPF0208 family proteins are found across multiple bacterial species

    • Comparative sequence analysis can identify conserved motifs potentially involved in pressure sensing

    • Evolutionary rate analysis can highlight regions under selective pressure

  • Cross-species comparison:

    • Analysis of homologs in other piezophiles vs. non-piezophiles

    • Identification of unique features in pressure-adapted variants

    • Correlation of sequence features with optimal growth pressure

  • Functional conservation:

    • Complementation studies in different piezophiles

    • Analysis of co-evolution with other pressure-responsive systems

    • Assessment of pressure-dependent expression patterns across species

This comparative approach can provide insight into whether PBPRA2797 represents a specialized adaptation in P. profundum or is part of a more conserved pressure-response mechanism.

How can immunological techniques be applied to study PBPRA2797 expression and localization?

While not directly addressed in the provided search results for PBPRA2797, immunological techniques used in similar recombinant protein studies can be applied:

  • Antibody development:

    • Generation of polyclonal antibodies against recombinant PBPRA2797

    • Epitope mapping to identify accessible regions for antibody recognition

    • Production of monoclonal antibodies for specific detection

  • Expression analysis:

    • Western blot analysis to quantify expression levels under different pressure conditions

    • Immunofluorescence microscopy to determine subcellular localization

    • Flow cytometry for population-level expression analysis

  • Functional immunological approaches:

    • Antibody-mediated functional blocking studies

    • Immunoprecipitation of protein complexes

    • ChIP-seq analysis if involved in nucleic acid binding

Drawing from methodologies used with other bacterial proteins , these immunological approaches could provide valuable insights into PBPRA2797 biology.

What considerations should be made when designing experiments to study PBPRA2797 function under pressure?

Studying PBPRA2797 under native pressure conditions requires specialized equipment and experimental design:

  • Pressure cultivation systems:

    • High-pressure cultivation vessels with temperature control

    • Batch vs. continuous culture optimization for reproducibility

    • Sampling mechanisms that maintain pressure during collection

  • Protein activity assays:

    • Pressure-resistant fluorescent reporters

    • Real-time monitoring systems compatible with pressure vessels

    • Rapid decompression protocols to preserve protein state

  • Structural studies under pressure:

    • High-pressure NMR systems

    • Pressure-adapted crystallography setups

    • Computational modeling of pressure effects on structure

  • Experimental controls:

    • Pressure-insensitive proteins as negative controls

    • Known pressure-responsive systems as positive controls

    • Careful time-course studies to distinguish immediate vs. adaptive responses

These considerations are essential when designing experiments to understand the true biological function of PBPRA2797 in its native high-pressure environment .

What emerging technologies might advance our understanding of PBPRA2797 function?

Several cutting-edge technologies could significantly enhance our understanding of PBPRA2797:

  • Cryo-electron tomography for visualizing membrane proteins in their native cellular context

  • AlphaFold2 and other AI-based structure prediction tools to model PBPRA2797 structure

  • Single-molecule force spectroscopy to examine pressure effects on protein stability

  • Nanopore recording systems for potential transport activity measurement

  • Microfluidic pressure chambers for real-time observation of cellular responses

  • CRISPR-Cas9 genome editing in P. profundum for precise genetic manipulation

  • Synthetic biology approaches to reconstruct minimal pressure-responsive systems

These emerging methods could provide unprecedented insights into the structural dynamics and functional roles of PBPRA2797 in pressure adaptation.

How might understanding PBPRA2797 contribute to broader knowledge in membrane protein biology?

Research on PBPRA2797 has potential to contribute to multiple areas of biological science:

  • Fundamental principles of membrane protein folding and stability under extreme conditions

  • Mechanisms of pressure sensing in biological systems

  • Evolution of piezophilic adaptations at the molecular level

  • Structure-function relationships in UPF0208 family proteins

  • Engineering principles for pressure-resistant proteins with potential biotechnological applications

  • Comparative biology of extremophile adaptations across different environmental stressors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.