Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
rseP; Protease RseP; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Species
Photorhabdus luminescens (Xenorhabdus luminescens)
Target Protein Sequence
VEKVIPGSAAEKAGLQKGDRIVKVGSQEIDVWHTFTSFVSNNPNVPLELSVDRAGHIISL
SMTPEVRQQSGGRKVGFAGVELRIVPLADEYKIVQQYGPFSAMYQAGDKTWQLMRLTVSM
IGKLIVGDVKINNLSGPISIAKGAGVSADSGLVYYLMFLALISVNLGIINLIPLPVLDGG
HLLFLFIEKIKGGPVSERVQDFSYRIGAMILVLLMGLALFNDFSRF