Recombinant Photorhabdus luminescens subsp. laumondii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Photorhabdus luminescens is a Gram-negative bacterium known for its symbiotic relationship with entomopathogenic nematodes, which together infect and kill insect hosts . P. luminescens produces a range of toxins and virulence factors that contribute to its pathogenicity . ATP synthase, a vital enzyme complex, is responsible for synthesizing adenosine triphosphate (ATP), the primary energy currency of cells . The ATP synthase subunit b (atpF) is a component of this enzyme complex. Recombinant forms of this subunit are produced using genetic engineering techniques for research purposes .

Background on ATP Synthase

ATP synthase (F₀F₁-ATPase) is a universal enzyme found in the cell membranes of bacteria, mitochondria, and chloroplasts . It harnesses the energy from a proton gradient across the membrane to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main functional units: F₀, which is embedded in the membrane and translocates protons, and F₁, which contains the catalytic sites for ATP synthesis .

Photorhabdus luminescens and its Virulence Factors

Photorhabdus luminescens subsp. laumondii is a subspecies of P. luminescens . This bacterium is known for producing various virulence factors, including toxins, proteases, and antimicrobial compounds, which aid in killing insect hosts and suppressing competing microorganisms .

Quorum Sensing and Global Expression Profiling

Quorum sensing (QS) is a regulatory mechanism used by bacteria to coordinate gene expression based on population density . In P. luminescens, QS plays a crucial role in regulating virulence, bioluminescence, and other important functions . Autoinducer 2 (AI-2) is one of the QS signal molecules . A study involving global expression profiling of P. luminescens subsp. laumondii TT01 showed that AI-2 regulates more than 300 genes involved in various cellular processes, including metabolism, biofilm formation, and oxidative stress resistance .

Recombinant Production of ATP Synthase Subunit b (atpF)

The recombinant form of ATP synthase subunit b (atpF) is produced by cloning the atpF gene from P. luminescens into an expression vector and expressing it in a host organism, such as E. coli . The recombinant protein can then be purified and used for biochemical and structural studies .

Function and Structure of ATP Synthase Subunit b

The ATP synthase subunit b (atpF) is a critical component of the F₀ complex. It forms a stalk-like structure that connects the F₀ and F₁ subunits, facilitating the transfer of torque generated by proton flow through F₀ to the F₁ subunit, which drives ATP synthesis .

7.1. Regulation of ATP Synthesis

The redox regulation mechanism responsible for efficient ATP production under varying light conditions in photosynthetic organisms has been unveiled . Researchers investigated the enzyme responsible for this mechanism and uncovered how the amino acid sequences present in the enzyme regulate ATP production .

7.2. Role of Amino Acid Sequences

To understand how the conformation of the amino acids present in chloroplast ATP synthase contributes to the redox regulation mechanism, researchers used the unicellular green alga, Chlamydomonas reinhardtii, to produce the enzyme . By leveraging the genetics of Chlamydomonas reinhardtii, they conducted a comprehensive biochemical analysis of the ATP synthase molecule .

7.3. Impact of bEBPs on Natural Product Biosynthesis

Working with the insect pathogen Photorhabdus laumondii, the effect of bacterial enhancer binding proteins (bEBPs) on natural product biosynthesis has been studied . It was found that the AAA+ ATPase core of the Sinorhizobium meliloti bEBP DctD induces expression of five natural product classes in P. laumondii TTO1 .

Potential Applications

Understanding the function and regulation of ATP synthase subunit b (atpF) in P. luminescens may have several potential applications:

  • Development of New Antimicrobials: Targeting ATP synthase could lead to the development of new antimicrobial agents against P. luminescens and related bacteria.

  • Enhancement of Biocontrol Strategies: Understanding the role of ATP synthase in the virulence of P. luminescens could help improve biocontrol strategies for insect pests.

  • Bioenergy: The results are an important step towards understanding the photosynthesis process better, with the potential for significant implications in the fields of agriculture and bioenergy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; plu0044; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
atpF
Target Protein Sequence
MNINATILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN ATDQMKKAKVEAQVIIEQANKQKAQILDDAKAEAEQERNRIVTQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous F1 catalytic core and the membrane-bound F0 proton channel, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links

KEGG: plu:plu0044

STRING: 243265.plu0044

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Photorhabdus luminescens?

ATP synthase subunit b (atpF) is an essential component of the F₁F₀-ATP synthase complex in P. luminescens. This protein functions as part of the stator, connecting the F₁ and F₀ portions of the ATP synthase. The subunit b helps anchor the catalytic F₁ sector to the membrane-embedded F₀ sector, maintaining structural integrity during the rotary mechanism of ATP synthesis . In P. luminescens, this complex is particularly important for energy production during various life cycle stages, including symbiosis with nematodes and pathogenicity to insects.

How does the atpF protein structure in P. luminescens compare to homologs in other bacterial species?

The atpF protein in P. luminescens shares the conserved structural features typical of bacterial ATP synthase b subunits, including:

  • An N-terminal membrane-spanning domain

  • A central dimerization domain

  • A C-terminal domain that interacts with the F₁ sector

While the core functional domains remain conserved across bacterial species, P. luminescens atpF shows specific amino acid sequences that may reflect adaptations to the organism's unique lifecycle requirements. These adaptations may influence how the ATP synthase functions during the transition between the bacterium's symbiotic and pathogenic phases .

What is known about the genetic organization of the ATP synthase operon in P. luminescens?

The ATP synthase genes in P. luminescens are organized in an operon structure similar to other bacteria. The complete operon includes:

GeneProteinFunction
atpISubunit iAccessory subunit with unclear function
atpBSubunit aProton channel component
atpESubunit cForms the c-ring rotor
atpFSubunit bStator stalk component
atpHSubunit δConnects F₁ to F₀
atpASubunit αNucleotide binding
atpGSubunit γCentral rotor shaft
atpDSubunit βCatalytic subunit
atpCSubunit εRegulates ATP hydrolysis

The operon is regulated in response to energy demands and environmental conditions, which is particularly important for P. luminescens as it transitions between different hosts and environmental conditions .

What are the optimal conditions for heterologous expression of recombinant P. luminescens atpF?

For optimal heterologous expression of recombinant P. luminescens atpF, researchers should consider the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) or similar strains are typically used due to their reduced protease activity and high expression capabilities.

  • Vector optimization: Vectors containing T7 or similar strong promoters with appropriate fusion tags (His6, GST, or MBP) facilitate both expression and subsequent purification.

  • Expression conditions:

    • Temperature: 18-25°C (reduced temperature often improves proper folding)

    • Induction: 0.1-0.5 mM IPTG for T7-based systems

    • Duration: 4-16 hours (overnight expression at lower temperatures often yields better results)

    • Media: Enriched media such as TB or 2xYT can improve yields

  • Codon optimization: P. luminescens has different codon usage compared to E. coli; codon optimization or expression in Rosetta strains may improve yields .

What purification strategies are most effective for isolating recombinant atpF with high purity?

A multi-step purification protocol for obtaining high-purity recombinant atpF typically includes:

  • Initial capture:

    • For His-tagged constructs: IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA or Co-based resins

    • Buffer conditions: 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0), 100-500 mM NaCl, 10-20 mM imidazole

  • Intermediate purification:

    • Ion exchange chromatography (typically anion exchange using Q Sepharose)

    • Buffer conditions: 20 mM Tris-HCl (pH 8.0), gradient elution with 0-500 mM NaCl

  • Polishing step:

    • Size exclusion chromatography (Superdex 75 or 200)

    • Buffer conditions: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl

  • Special considerations:

    • Addition of mild detergents (0.03-0.1% DDM or LDAO) may improve stability and prevent aggregation

    • Inclusion of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) can prevent oxidation

    • Protease inhibitors should be included in initial lysis buffers

How can researchers assess the proper folding and functional integrity of recombinant atpF?

To assess proper folding and functional integrity of recombinant atpF, researchers should employ multiple complementary techniques:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal shift assays to determine stability and proper folding

    • Dynamic light scattering to assess homogeneity and detect aggregation

  • Functional assays:

    • In vitro reconstitution with other ATP synthase subunits to assess complex formation

    • Co-immunoprecipitation experiments with partner subunits (particularly α and β subunits)

    • ATP hydrolysis activity measurements in reconstituted systems

  • Structural validation:

    • Limited proteolysis to assess domain organization and folding

    • Native PAGE to evaluate oligomeric state

    • Analysis of tryptophan fluorescence for tertiary structure assessment

What techniques are recommended for studying the interaction between atpF and other ATP synthase subunits?

Several robust techniques can be employed to study interactions between atpF and other ATP synthase subunits:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interaction studies in solution

  • Co-purification approaches:

    • Pull-down assays using differently tagged subunits

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Native mass spectrometry to determine stoichiometry

  • Crosslinking strategies:

    • Chemical crosslinking combined with mass spectrometry (XL-MS)

    • Photo-activatable proximity labeling

    • Site-specific incorporation of crosslinkable amino acids

  • Structural biology methods:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography of subcomplexes

    • NMR for mapping interaction interfaces of isolated domains

How does P. luminescens atpF compare with homologs from other pathogenic bacteria?

The atpF protein from P. luminescens shares several conserved features with homologs from other pathogenic bacteria, but also displays distinct characteristics:

Key differences in P. luminescens atpF likely reflect adaptations to its unique lifecycle, which involves transitions between insect pathogenesis and nematode symbiosis. These adaptations may influence how the ATP synthase complex responds to the dramatically different environments encountered during these phases .

What evolutionary insights can be gained from studying P. luminescens ATP synthase components?

Studying P. luminescens ATP synthase components, particularly atpF, provides valuable evolutionary insights:

  • Adaptation signatures: Comparative analysis reveals specific amino acid substitutions that may represent adaptations to P. luminescens' dual lifestyle as both an insect pathogen and nematode symbiont.

  • Horizontal gene transfer: Analysis of GC content and codon usage in the ATP synthase operon can reveal evidence of potential horizontal gene transfer events, similar to what has been observed with other operons in P. luminescens .

  • Co-evolution patterns: The patterns of sequence conservation between atpF and its interacting partners within the ATP synthase complex reflect co-evolutionary constraints maintaining functional interactions.

  • Selective pressures: The ratio of synonymous to non-synonymous substitutions in atpF sequences across P. luminescens strains can identify regions under different selective pressures.

  • Functional constraints: Highly conserved residues across diverse bacterial species highlight functionally critical positions that cannot tolerate variation despite divergent evolutionary histories .

How can researchers investigate the role of atpF in the broader energy metabolism of P. luminescens?

To investigate the role of atpF in P. luminescens energy metabolism, researchers can implement a multi-faceted approach:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 or lambda Red recombineering for generating conditional knockdowns

    • Site-directed mutagenesis of key residues to create partially functional variants

    • Construction of chimeric atpF proteins with domains from other species

  • Metabolic analysis:

    • ^13C metabolic flux analysis to trace carbon flow in wild-type vs. atpF mutants

    • Metabolomics profiling to identify metabolite changes in response to atpF alterations

    • Measurement of NAD+/NADH and ATP/ADP ratios under different growth conditions

  • Physiological characterization:

    • Growth curve analysis under various energy sources and stress conditions

    • Membrane potential measurements using fluorescent probes

    • Oxygen consumption rates and proton pumping efficiency assessments

  • Systems biology approaches:

    • Integration with transcriptomics data to identify compensatory responses

    • Protein-protein interaction network mapping centered on ATP synthase

    • Flux balance analysis modeling with constraints derived from experimental data

What methodologies are recommended for studying how atpF might contribute to P. luminescens pathogenicity?

To study how atpF contributes to P. luminescens pathogenicity, researchers should consider these methodological approaches:

  • Infection model systems:

    • Galleria mellonella (wax moth) larvae infection assays

    • Tissue culture infection models using insect cell lines

    • Co-culture systems with symbiotic nematodes (Heterorhabditis)

  • Virulence assessment techniques:

    • LD50 determination with wild-type and atpF mutant strains

    • Time-course analysis of bacterial proliferation in host tissues

    • Host immune response measurements (antimicrobial peptide production, hemocyte responses)

  • Molecular mechanisms investigation:

    • Transcriptional profiling of virulence factors in atpF mutants

    • Analysis of secreted toxin levels using proteomic approaches

    • Assessing the impact on quorum sensing systems, which are known to regulate virulence in P. luminescens

  • Environmental adaptation studies:

    • Survival assays under conditions mimicking insect hemolymph

    • Response to oxidative stress challenges typical during infection

    • Adaptation to pH fluctuations encountered during host colonization

How does ATP synthase reverse activity impact P. luminescens energy homeostasis and potential therapeutic targets?

The reverse activity of ATP synthase, where it consumes ATP to pump protons, has significant implications for P. luminescens energy homeostasis and potential therapeutic development:

What are the common challenges in expressing and purifying functional recombinant atpF, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant atpF:

  • Insolubility and inclusion body formation:

    • Challenge: The hydrophobic N-terminal region often leads to aggregation.

    • Solutions: (a) Express as fusion with solubility-enhancing tags (MBP, SUMO); (b) Lower induction temperature to 16-18°C; (c) Reduce IPTG concentration to 0.1-0.2 mM; (d) Consider cell-free expression systems.

  • Protein instability after purification:

    • Challenge: Isolated atpF may denature rapidly without its native interaction partners.

    • Solutions: (a) Include stabilizing agents like glycerol (10-20%) and mild detergents; (b) Co-express with interacting subunits; (c) Optimize buffer conditions with thermal shift assays.

  • Improper folding:

    • Challenge: Recombinant atpF may not adopt native conformation.

    • Solutions: (a) Co-express with chaperones (GroEL/GroES, DnaK); (b) Implement slow refolding protocols from purified inclusion bodies; (c) Add folding enhancers like arginine or proline to buffers.

  • Low yields:

    • Challenge: Expression levels may be insufficient for structural or biochemical studies.

    • Solutions: (a) Optimize codon usage for expression host; (b) Screen multiple expression strains; (c) Explore alternative promoters; (d) Scale up cultivation volume .

How can researchers troubleshoot activity assays for recombinant P. luminescens ATP synthase complexes?

Troubleshooting functional assays for reconstituted ATP synthase complexes containing recombinant atpF requires systematic analysis:

  • ATP hydrolysis activity issues:

    • Problem: Low or absent ATPase activity.

    • Troubleshooting: (a) Verify all subunits are present in proper stoichiometry using SDS-PAGE; (b) Check buffer conditions, especially Mg²⁺ concentration; (c) Ensure absence of inhibitors like azide; (d) Verify pH is optimal (typically 7.5-8.0).

  • Reconstitution into liposomes:

    • Problem: Poor incorporation efficiency.

    • Troubleshooting: (a) Optimize lipid composition to include bacterial lipids; (b) Adjust protein:lipid ratio; (c) Try different detergent removal methods (dialysis, Bio-Beads, gel filtration).

  • Proton pumping assessment:

    • Problem: Unable to detect proton gradient formation.

    • Troubleshooting: (a) Verify integrity of liposomes using calcein leakage assays; (b) Ensure sufficient ATP concentration; (c) Check pH indicator dye concentration and sensitivity; (d) Control for non-specific ion leakage.

  • Integration of assay components:

    • Problem: Inconsistent results between preparations.

    • Troubleshooting: (a) Standardize protein preparation protocols; (b) Prepare larger batches of liposomes; (c) Include known standards in each experiment; (d) Control temperature precisely during measurements .

What emerging technologies could advance our understanding of P. luminescens atpF structure-function relationships?

Several cutting-edge technologies hold promise for elucidating atpF structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural determination of the entire ATP synthase complex

    • Visualization of different conformational states during catalytic cycle

    • Identification of P. luminescens-specific structural features

  • Integrative structural biology approaches:

    • Combining crystallography, NMR, and molecular dynamics simulations

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry to map precise interaction interfaces

  • Advanced genomic tools:

    • CRISPR-dCas9 based approaches for precision regulation of atpF expression

    • Deep mutational scanning to comprehensively assess functional impact of mutations

    • Single-cell techniques to examine heterogeneity in expression and function

  • In situ structural techniques:

    • Cryo-electron tomography to visualize ATP synthase in cellular context

    • Super-resolution microscopy to track dynamics in living cells

    • Correlative light and electron microscopy for functional-structural integration

How might research on P. luminescens atpF contribute to broader understanding of bacterial bioenergetics?

Research on P. luminescens atpF has several potential impacts on our broader understanding of bacterial bioenergetics:

  • Adaptation mechanisms:

    • Insights into how ATP synthase is modified for different environmental niches

    • Understanding energy production during host-switching between insects and nematodes

    • Revealing adaptations that balance energy efficiency with environmental flexibility

  • Regulatory networks:

    • Elucidation of how ATP synthase activity integrates with broader metabolic regulation

    • Understanding crosstalk between respiratory chain and ATP synthesis

    • Characterization of condition-specific inhibitory mechanisms similar to ATPIF1

  • Evolutionary perspectives:

    • Comparative analysis with other bacterial ATP synthases to identify convergent adaptations

    • Understanding how horizontal gene transfer influences bioenergetic machinery

    • Insights into co-evolution of ATP synthase components with other cellular systems

  • Therapeutic implications:

    • Development of targeted approaches for disrupting bacterial energy metabolism

    • Identification of unique features that could be exploited for antimicrobials

    • Understanding resistance mechanisms against existing ATP synthase inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.