Recombinant Photorhabdus luminescens subsp. laumondii Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Genomic Features and Ecological Significance

Photorhabdus luminescens is an entomopathogenic bacterium that maintains a symbiotic relationship with soil nematodes while acting as a broad-spectrum insect pathogen. The complete genome sequence of P. luminescens strain TT01 spans 5,688,987 base pairs and contains 4,839 predicted protein-coding genes . This bacterium has garnered significant scientific interest due to its complex lifestyle, which involves transitioning between a symbiotic phase in the nematode gut and a virulent phase in insect larvae. Its genomic composition reflects this multifaceted ecological role, encoding numerous adhesins, toxins, hemolysins, proteases, and lipases that facilitate its pathogenic capabilities .

The life cycle of P. luminescens is intricately linked to its nematode host, which serves as a vector for bacterial transmission among susceptible insect populations. Upon entering an insect host, P. luminescens releases various virulence factors that rapidly kill the insect through toxemia and septicemia. The bacterium then produces exoenzymes that bioconvert the insect cadaver, allowing both the bacteria and nematodes to multiply . During this process, P. luminescens synthesizes antibiotics that prevent invasion by competing microorganisms, ensuring exclusive access to the nutrient-rich environment of the insect cadaver.

Metabolic Versatility and Biosynthetic Pathways

P. luminescens demonstrates remarkable metabolic versatility, including sophisticated biosynthetic pathways for producing various essential compounds. Among these pathways, cobalamin (vitamin B12) biosynthesis represents a critical metabolic function that supports the bacterium's complex lifestyle. The CobD protein, encoded by the cobD gene, is an essential component of this biosynthetic pathway, contributing to the organism's metabolic self-sufficiency in nutrient-limited environments such as insect hemolymph.

The bacterium's ability to synthesize cobalamin likely provides a competitive advantage during both the symbiotic and pathogenic phases of its lifecycle. This capability may be particularly important during the insect infection stage, where rapid growth and reproduction necessitate efficient metabolism that depends on cobalamin-requiring enzymes.

Overview of Vitamin B12 Biosynthesis

Cobalamin (vitamin B12) represents one of the most structurally complex small molecules synthesized in nature. Its biosynthesis requires approximately 30 enzymatic steps and occurs through either an aerobic or anaerobic pathway. The fundamental difference between these pathways lies in the timing of cobalt insertion and the requirement for oxygen in specific reactions. In both pathways, the assembly of the corrin ring structure represents a central and highly regulated process.

The biosynthesis of cobalamin involves the construction of a corrin ring, attachment of various side chains, insertion of a cobalt ion, and assembly of the lower axial ligand. This lower ligand typically consists of 5,6-dimethylbenzimidazole (DMB) in cobalamin, though alternative bases can be incorporated in cobalamin variants . The diversity of cobalamin forms is biologically significant, as different organisms exhibit selective utilization of specific variants.

The CobD Enzyme: L-Threonine-O-3-phosphate Decarboxylase Activity

Based on studies of homologous proteins, the CobD enzyme from P. luminescens likely functions as an L-threonine-O-3-phosphate decarboxylase, converting L-threonine-O-3-phosphate to (R)-1-amino-2-propanol O-3-phosphate during the biosynthesis of the lower ligand of cobalamin. This reaction represents a critical step in the assembly of the DMB moiety that forms part of the complete cobalamin molecule. While direct experimental evidence on P. luminescens CobD is limited in the available literature, functional conservation among CobD proteins suggests this enzymatic role.

In Methanosarcina mazei, a well-studied archaeal model, the CobD enzyme (MmCobD) exhibits dual functionality, possessing both L-threonine kinase (PduX) and L-threonine-O-3-phosphate decarboxylase (CobD) activities . This bifunctional nature represents an interesting evolutionary adaptation that streamlines the biosynthetic pathway. Whether the P. luminescens CobD possesses similar dual functionality remains an open question for future research.

Domain Architecture and Metal Binding

Studies of CobD proteins from other organisms provide valuable insights into the likely structural features of P. luminescens CobD. The M. mazei CobD protein contains a characteristic C-terminal extension annotated as a metal-binding domain, which has been experimentally determined to be a non-heme iron-binding region rather than the putative zinc finger originally suggested by sequence analysis . This C-terminal domain contains approximately 25 iron atoms per protein monomer and features conserved cysteine and histidine residues arranged in specific patterns that coordinate metal binding.

While the presence of a similar iron-binding domain in P. luminescens CobD has not been directly confirmed, sequence analysis may reveal conserved cysteine and histidine patterns that would suggest comparable metal-binding capacity. The metal-binding capability of CobD proteins appears functionally important, as mutations in the metal-coordinating residues result in decreased enzymatic activity both in vitro and in vivo .

Comparative Analysis with Homologous Proteins

The metal-binding domains associated with CobD proteins can be categorized into three groups based on sequence homology :

GroupCharacteristicsOrganismal DistributionConserved Features
AFused to CobD C-terminusMethanogenic EuryarchaeotaSequence gaps at positions 423 and 434; lacks several conserved residues found in groups B and C
BIndependent open reading framesBacteriaContains conserved F/Y404, F407, N/H409 residues
CIndependent open reading framesBacteriaContains conserved Y/H466 residue

Based on taxonomic relationships, the P. luminescens CobD protein likely belongs to either group B or C, featuring a metal-binding domain with the corresponding conserved residues. This classification provides a framework for predicting the structural and functional properties of the protein.

Expression Systems and Purification Methods

Recombinant production of P. luminescens CobD protein typically employs Escherichia coli expression systems, similar to other recombinant proteins from this organism. Based on established protocols for similar proteins, the following expression and purification approach is likely effective:

ParameterRecommended ConditionRationale
Expression HostE. coli BL21(DE3)High protein expression levels and reduced protease activity
Expression VectorpET system with N-terminal His-tagFacilitates purification via affinity chromatography
Induction Conditions0.5-1.0 mM IPTG, 16-20°C overnightLower temperature reduces inclusion body formation
Purification MethodNi-NTA affinity chromatographySelective binding of His-tagged protein
Secondary PurificationSize exclusion chromatographyRemoves aggregates and ensures homogeneity

The recombinant protein is typically obtained as a lyophilized powder after purification, with recommended storage at -20°C to -80°C to maintain stability . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week to preserve enzymatic activity .

Biochemical Properties and Activity Assays

The biochemical properties of recombinant P. luminescens CobD likely include:

PropertyPredicted CharacteristicsNotes
Molecular Weight~45-55 kDa (including His-tag)Based on typical size of CobD proteins
ColorBrown (if iron-binding domain present)Due to iron content in the C-terminal domain
pH Optimum7.5-8.5Typical for cytoplasmic enzymes
Temperature Optimum25-37°CReflective of physiological conditions
Cofactor RequirementsPyridoxal 5'-phosphate (PLP)Common for decarboxylases
Metal ContentIron (if C-terminal domain present)Approximately 25 non-heme iron atoms per monomer

Activity assays for recombinant CobD typically measure L-threonine-O-3-phosphate decarboxylase activity through either direct product detection or coupled enzymatic reactions. The enzymatic reaction can be monitored through:

  1. Direct measurement of (R)-1-amino-2-propanol O-3-phosphate formation

  2. Coupling to subsequent enzymes in the cobalamin biosynthetic pathway

  3. Measurement of released CO₂ using radiolabeled substrates

Biotechnological Applications

The recombinant P. luminescens CobD protein holds potential applications in several biotechnological areas:

  1. Enzymatic Production of Cobalamin Derivatives: The CobD enzyme could be employed in biocatalytic processes for synthesizing novel cobalamin derivatives with modified lower ligands, potentially yielding compounds with enhanced stability or bioavailability.

  2. Insecticidal Formulations: Understanding the role of CobD in P. luminescens metabolism may contribute to developing improved insecticidal formulations based on this bacterium, which has already shown promise as a biological control agent against agricultural pests .

  3. Diagnostic Tools: Antibodies raised against recombinant CobD could serve as diagnostic markers for detecting P. luminescens infections or for studying symbiotic associations with nematodes.

Future Research Directions

Several promising research directions could enhance our understanding of P. luminescens CobD:

  1. Crystal Structure Determination: Resolving the three-dimensional structure of P. luminescens CobD would provide insights into its catalytic mechanism and the architecture of its metal-binding domain.

  2. In vivo Function Studies: Gene knockout or knockdown experiments could elucidate the physiological role of CobD in P. luminescens, particularly its contribution to symbiosis and pathogenicity.

  3. Comparative Analysis: A systematic comparison of CobD proteins across different P. luminescens strains could reveal adaptive variations related to specific host ranges or environmental niches.

  4. Metal Binding Studies: Detailed investigation of the iron-binding properties of the C-terminal domain and its contribution to enzymatic activity would clarify the structure-function relationship.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
cobD; plu2998; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
cobD
Target Protein Sequence
MTLAAWFAAFLLDSWLGDPPHWPHPVRWIGKLISLVQRAVRRCCHSERALKVGGAGLWIV VVGLTWLVSWGCLWLMNAIHPWVGWLVEVWMIYTLLAGRCLSDTALEVHGVLQQGLLDES RQQLSWIVGRDTSQLDAPQITRAVVETVAENSVDGVIAPLFFLMIGGAPLAMAYKAINTL DSMVGYKTQEYHAIGYVSARMDDLANWLPARLSWLLLSAAAWFIRLDFRQALRIGWRDRY QHTSPNCGWSEATVAGALGIRLGGPSCYFGERVEKPWMGDERRKIALTDIPLSIYLMMIA SQLALLLFALLRLLLVGMA
Uniprot No.

Target Background

Function

This protein catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.

Database Links

KEGG: plu:plu2998

STRING: 243265.plu2998

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the cobD gene organized within the P. luminescens genome?

While the search results don't provide specific information about the genomic organization of cobD in P. luminescens, comparative analysis with related organisms suggests it likely exists within an operon structure dedicated to cobalamin biosynthesis. In other bacteria such as Salmonella enterica, the cobalamin biosynthetic genes are organized in a complex operon structure with regulatory elements that respond to environmental factors . P. luminescens as an entomopathogenic bacterium likely maintains tight regulation of its cobalamin biosynthesis genes, including cobD, to optimize production in relation to its lifecycle within insect hosts.

What is the relationship between CobD and other cobalamin biosynthesis proteins?

CobD works in concert with multiple enzymes in the cobalamin biosynthetic pathway. Based on studies in Salmonella enterica, CobD functions in conjunction with CbiB to facilitate the attachment of the aminopropanol component to cobyric acid . The pathway involves distinct sets of enzymes depending on whether synthesis occurs under aerobic or anaerobic conditions. CobD shares functional relationships with other enzymes involved in the later stages of cobalamin assembly, including CobT, CobS, and CobC, which collectively participate in the nucleotide loop assembly phase of cobalamin biosynthesis .

What structural features define P. luminescens CobD?

Although the specific structure of P. luminescens CobD has not been directly reported in the search results, structural insights can be inferred from the highly characterized Salmonella enterica CobD. The Salmonella CobD exists as a dimer where each subunit consists of a large and small domain . As a member of the aspartate aminotransferase family, P. luminescens CobD likely shares similar structural characteristics, with an active site configuration resembling that of histidinol phosphate aminotransferase . The structural elements would be organized to facilitate its specific decarboxylation function rather than amino transfer.

How does P. luminescens CobD compare structurally to homologs in other bacterial species?

The following table presents predicted structural comparisons between CobD proteins from different bacterial species:

FeatureP. luminescens CobD (predicted)S. enterica CobDE. coli CobD
Quaternary StructureDimericDimericDimeric
Domain OrganizationLarge and small domains per subunitLarge and small domains per subunitLarge and small domains per subunit
Active Site SimilarityHistidinol phosphate aminotransferase-likeHistidinol phosphate aminotransferase-likeHistidinol phosphate aminotransferase-like
PLP BindingConserved lysine residueConserved lysine residueConserved lysine residue
Substrate SpecificityL-threonine O-3-phosphateL-threonine O-3-phosphateL-threonine O-3-phosphate

What expression systems are most effective for producing recombinant P. luminescens CobD?

For recombinant expression of P. luminescens CobD, E. coli-based expression systems typically provide the most efficient platform. A methodological approach would include:

  • Gene amplification and cloning into a suitable expression vector (pET series vectors are commonly used for protein purification purposes).

  • Transformation into an E. coli expression strain such as BL21(DE3) or Rosetta(DE3) to account for potential codon bias.

  • Induction of protein expression using IPTG at optimized temperature conditions (often 16-18°C overnight induction yields better soluble protein than standard 37°C expression).

  • Cell lysis and purification using affinity chromatography (His-tag purification is commonly employed, followed by size exclusion chromatography).

Considerations should be made for the dimeric nature of the protein, ensuring that expression conditions preserve the native oligomeric state. Additionally, as CobD is functionally related to pyridoxal-5′-phosphate (PLP)-dependent enzymes, supplementation with PLP during purification may enhance stability and activity of the recombinant protein.

What assay methods can be employed to measure CobD enzymatic activity?

The enzymatic activity of recombinant P. luminescens CobD can be measured through several complementary approaches:

  • Decarboxylation assay monitoring the conversion of L-threonine O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate.

  • Detection of CO2 release using radioactive substrates or specialized CO2 capture methods.

  • Coupled enzyme assays where the product formation is linked to a detectable enzymatic reaction.

  • HPLC or LC-MS methods to directly quantify substrate consumption and product formation.

A methodological protocol would involve:

  • Preparing reaction mixtures containing purified CobD, L-threonine O-3-phosphate substrate, PLP cofactor, and appropriate buffer conditions.

  • Incubating reactions at optimal temperature (typically 30-37°C).

  • Quenching reactions at defined time points.

  • Analyzing reaction products using chromatographic techniques.

  • Calculating enzymatic parameters based on product formation rates.

This approach allows for determination of kinetic parameters and can be adapted to assess the effects of inhibitors or activators on enzyme activity.

How does P. luminescens CobD's catalytic mechanism differ from canonical PLP-dependent decarboxylases?

The catalytic mechanism of P. luminescens CobD likely follows the general principles of PLP-dependent decarboxylases but with specific adaptations that favor decarboxylation over transamination. Based on studies of the Salmonella enterica CobD, the enzyme has evolved structural features that direct the breakdown of the external aldimine complex toward decarboxylation rather than amino transfer .

The reaction mechanism likely proceeds through:

  • Formation of an internal aldimine between PLP and a conserved lysine residue in the active site.

  • Substrate binding and transaldimination to form an external aldimine.

  • Decarboxylation of the substrate-PLP complex.

  • Protonation at the α-carbon position.

  • Hydrolysis to release the (R)-1-amino-2-propanol O-2-phosphate product.

The specific orientation of active site residues creates an environment that stabilizes the carbanion intermediate following decarboxylation, directing the reaction toward the formation of the aminopropanol product rather than alternative reactions possible with PLP-dependent enzymes.

What is the significance of CobD's subcellular localization in P. luminescens?

In Salmonella, the CobS enzyme (which functions in the same pathway as CobD) shows a pattern of localization to the inner membrane . This pattern is shared by the CbiB enzyme, which catalyzes the last step of the de novo corrin ring biosynthetic pathway . By analogy, P. luminescens CobD may also exhibit membrane association, which would facilitate the spatial organization of sequential enzymatic reactions in the cobalamin biosynthetic pathway.

The potential membrane localization raises interesting questions about how the pathway is organized within the bacterial cell and how intermediates are channeled between enzymes. This spatial organization may be particularly important in entomopathogenic bacteria like P. luminescens, where cobalamin production might be coordinated with other metabolic processes related to insect pathogenesis.

How is cobD gene expression regulated in response to environmental conditions?

The regulation of cobD expression in P. luminescens likely responds to multiple environmental factors, including oxygen availability, cobalt concentration, and nutritional status. In other bacteria, cobalamin biosynthesis genes are typically regulated through complex mechanisms involving both transcriptional and post-transcriptional control.

For P. luminescens as an entomopathogenic bacterium, the regulation may be particularly tuned to the insect host environment. The bacterium transitions between life in the soil and within insect hosts, which may necessitate different patterns of cobalamin biosynthesis gene expression. Additionally, P. luminescens harbors LuxR solos including SdiA, which has a signal-binding domain that could potentially influence metabolic pathways including cobalamin biosynthesis .

The following regulatory mechanisms are likely involved:

  • Transcriptional regulation by specific transcription factors that respond to cobalamin levels or precursors.

  • Riboswitch-mediated regulation, where cobalamin or its intermediates directly affect mRNA stability or translation.

  • Integration with global regulatory networks that respond to environmental stresses or host-derived signals.

  • Potential cross-talk with quorum sensing systems, given P. luminescens's complex lifestyle as both a symbiont of nematodes and a pathogen of insects.

How does the cobalamin biosynthetic pathway in P. luminescens compare to pathways in other bacteria?

The cobalamin biosynthetic pathway in P. luminescens likely shares fundamental similarities with pathways in other bacteria, but may have specific adaptations related to its lifestyle as an insect pathogen. Based on the available search results, we can compare the general features of cobalamin biosynthesis across different bacterial species.

Bacteria utilize two main routes for cobalamin biosynthesis: aerobic and anaerobic pathways, which differ primarily in the timing of cobalt insertion and the mechanism of ring contraction . The table below compares key features of these pathways across different bacterial species:

FeatureAerobic Pathway (P. denitrificans)Anaerobic Pathway (S. enterica)Predicted P. luminescens Pathway
Cobalt InsertionLate stageEarly stageLikely early stage (anaerobic)
Ring ContractionOxygen-dependentOxygen-independentLikely oxygen-independent
Key EnzymesCobG, CobF, CobJCbiH, CbiG, CbiDLikely CbiH, CbiG, CbiD homologs
CobD FunctionAminopropanol synthesisAminopropanol synthesisAminopropanol synthesis
RegulationOxygen-responsiveAdoCbl-responsiveLikely responsive to insect host signals

What evolutionary insights can be derived from studying P. luminescens CobD?

Studying P. luminescens CobD provides valuable evolutionary insights into both enzyme evolution and the adaptation of metabolic pathways. The CobD enzyme belongs to a family of PLP-dependent enzymes that includes aminotransferases, with structural similarities to histidinol phosphate aminotransferase . This relationship suggests an evolutionary history where an ancestral PLP-dependent enzyme diversified to catalyze different reactions while maintaining core structural features.

In the context of P. luminescens's lifestyle as an insect pathogen, the evolution of its cobalamin biosynthetic pathway, including CobD, may reflect adaptations to the unique environmental challenges it faces. The bacterium transitions between existence in soil, symbiosis with nematodes, and pathogenesis in insects, each environment potentially imposing different selective pressures on cobalamin metabolism.

Comparative analysis of CobD sequences and structures across diverse bacterial species could reveal:

  • Conservation patterns in catalytic residues versus diversity in peripheral structures.

  • Evidence of horizontal gene transfer events in the distribution of cobalamin biosynthesis genes.

  • Correlations between pathway variations and ecological niches occupied by different bacteria.

  • Potential co-evolution with other metabolic systems relevant to P. luminescens's lifestyle, such as those involved in producing insecticidal toxins or managing host-derived stress.

What are the current technical limitations in studying P. luminescens CobD?

Several technical challenges complicate the comprehensive study of P. luminescens CobD:

  • Expression and purification challenges: Like other cobalamin biosynthesis enzymes, CobD may be difficult to express in high yields. For example, CobS (another enzyme in the pathway) could only be isolated in small amounts (~0.2 mg/liter of culture) despite numerous optimization efforts .

  • Substrate availability: The natural substrate, L-threonine O-3-phosphate, is not commercially available and must be synthesized, adding complexity to enzymatic assays.

  • Assay development: Measuring decarboxylase activity requires specialized techniques to detect either CO2 release or the formation of the aminopropanol product.

  • Structural studies: If P. luminescens CobD shares the membrane association pattern observed with other cobalamin biosynthesis enzymes, this could complicate structural studies requiring protein crystallization.

  • Genetic manipulation: While genetic tools exist for P. luminescens, they may not be as well-developed as those for model organisms, potentially limiting in vivo studies of CobD function.

How can advanced technologies enhance our understanding of P. luminescens CobD?

Emerging technologies offer new approaches to overcome challenges in studying P. luminescens CobD:

  • Cryo-electron microscopy (cryo-EM): This technique can potentially determine the structure of CobD without the need for crystallization, particularly valuable if the protein resists crystallization efforts.

  • Single-molecule enzymology: Techniques to study individual enzyme molecules could provide insights into the conformational changes and catalytic events during CobD's reaction cycle.

  • In-cell NMR spectroscopy: This approach could allow study of CobD structure and dynamics in its native cellular environment, revealing physiologically relevant interactions.

  • Genome editing with CRISPR-Cas9: Precise genetic modifications can create targeted mutations in cobD to assess their impact on enzyme function and cobalamin production in vivo.

  • Metabolomics approaches: Comprehensive analysis of metabolite profiles in wild-type and cobD-mutant P. luminescens could reveal the broader metabolic context of CobD function.

  • Protein engineering: Directed evolution or rational design approaches could generate CobD variants with enhanced stability or catalytic efficiency, facilitating biochemical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.