Recombinant Photorhabdus luminescens subsp. laumondii Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Description

Overview

The Rnf complex is a redox-driven ion pump present in various bacteria and archaea, that couples cellular ferredoxin to the pyridine nucleotide pool . Photorhabdus luminescens is a bacterium that belongs to the Enterobacteriaceae family and exists symbiotically with nematodes, which are lethal to insects . The RnfG protein is a subunit of the Rnf complex, an electron transport chain that facilitates energy conservation and reverse electron transport in bacteria .

Characteristics of RnfG

RnfG is a component of the Rnf complex, which is critical for energy conservation and reverse electron transport to drive ferredoxin reduction in many bacteria . The Rnf complex, including RnfG, is assumed to encode a membrane-bound enzyme complex with subunits . It is predicted that electron flow occurs from RnfB to RnfC via RnfA and RnfG .

Rnf Complex

Rnf complexes are redox-driven ion pumps found in bacteria and archaea . They couple cellular ferredoxin to the pyridine nucleotide pool . The rnf genes encode a membrane-bound enzyme that oxidizes reduced ferredoxin and reduces NAD, coupled to ion transport across the cytoplasmic membrane .

Photorhabdus luminescens

Photorhabdus luminescens subsp. laumondii also has a probable intracellular septation protein A (Plu2483), which is a protein that may be involved in cell division .

Recombinant Photorhabdus luminescens subsp. laumondii Probable Intracellular Septation Protein A(Plu2483) Protein

Recombinant Full Length Photorhabdus luminescens subsp. laumondii Probable intracellular septation protein A(plu2483) Protein (Q7N471) (1-178aa), fused to N-terminal His tag, can be expressed in E. coli .

  • AA Sequence: MKQLLDFLPLVVFFVVYKMYDIFYASGALIAATGLAVAMTYFIYRKVEKASLITFIMVAV FGTLTLAFHSDLFIKWKVTVIYALFALALLGSQWFMKKPLIQKMLGKELILPDLVWNKLN MAWALFFTACALANIYVAFWLPQDVWVNFKVFGLTALTLVFTVLSVVYIYRHLPREQK

  • Synonyms: yciB; plu2483; Inner membrane-spanning protein YciB

Tables related to Recombinant Full Length Photorhabdus Luminescens Subsp. Laumondii Probable Intracellular Septation Protein A(Plu2483) Protein, His-Tagged

Cat.No. :RFL34869PF
Species :Photorhabdus luminescens
Source :E.coli
Tag :His
Protein Length :Full Length (1-178)
Form :Lyophilized powder
Purity :Greater than 90% as determined by SDS-PAGE.
Storage :Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer :Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene Nameplu2483
UniProt IDQ7N471

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfG; plu2381; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
rnfG
Target Protein Sequence
MLETMRRHGITLAIFAALTTGLTAVVNSLTKSTIAEQAALQHKSLLDQVIPPALYDNDIQ NECYLVNANALGNNLPHRLYLARKNGHPVAAALESTAPDGYSGAIQLLVGADFSGKVLGV RVTEHHETPGLGDKIETRISNWINVFSGKTITSNHDQHWAVKKDGGEFDQFTGATITPRA VVNSVKRTALYLQTIPEHLSSLESCGEKS
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links

KEGG: plu:plu2381

STRING: 243265.plu2381

Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Rnf complex in Photorhabdus luminescens and what role does RnfG play?

The Rnf complex in bacteria like Photorhabdus luminescens functions as an electron transport complex that couples the flow of electrons to ion translocation across the cell membrane. RnfG represents a critical component of this complex, containing covalently bound FMN (flavin mononucleotide) at threonine-175. This flavoprotein participates in electron transfer reactions within the complex, allowing for energy conservation through ion gradient formation .

Recent spectroscopic studies have demonstrated that RnfG produces a neutral semiquinone intermediate upon partial reduction, which is a characteristic feature important for its electron transfer function. This semiquinone species disappears upon full reduction and is not observed in denatured protein, indicating its structural dependence on proper protein folding .

How does the RnfG protein in P. luminescens compare to homologous proteins in other bacterial species?

The RnfG protein in P. luminescens shares significant structural and functional similarities with homologous proteins in other bacterial species, particularly with subunit C of the Na⁺-NQR complex. Both contain a conserved S(T)GAT motif with FMN covalently bound to the final threonine residue .

What genomic information is available for P. luminescens subsp. laumondii that would help in RnfG studies?

The draft genome sequence of P. luminescens subsp. laumondii HP88 provides valuable information for RnfG studies. This genome consists of 5.27 Mbp with a G+C content of 42.4% and contains 4,243 candidate protein-coding genes . The complete genome sequence is available in public databases (accession no. LJPB00000000) .

For researchers interested in gene regulation aspects, it's noteworthy that P. luminescens possesses quorum sensing mechanisms involving LuxS-like signaling, which has been shown to regulate other operons in this bacterium . Understanding these regulatory networks could provide insights into the expression patterns of rnfG and other components of the electron transport system.

What experimental approaches are most effective for expressing and purifying recombinant RnfG from P. luminescens?

Based on successful approaches with similar proteins, the most effective strategy for recombinant RnfG expression involves:

  • Vector Selection: Utilizing expression vectors with inducible promoters (such as T7 or arabinose-inducible systems) to control expression levels.

  • Host Selection: Expressing the protein in E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)). Alternative approaches include expressing in the native organism, as demonstrated for RnfG from Vibrio cholerae .

  • Purification Strategy:

    • Initial extraction using mild detergents (DDM or CHAPS) to solubilize membrane-associated proteins

    • Immobilized metal affinity chromatography (IMAC) with a His-tag

    • Size exclusion chromatography for final purification

  • Functional Verification: UV visualization of SDS-PAGE gels to confirm flavin incorporation, as successful RnfG expression should produce protein that fluoresces under UV illumination due to covalently bound FMN .

  • Cofactor Considerations: Supplementing growth media with riboflavin to ensure adequate FMN availability for proper folding and flavin incorporation.

How can researchers effectively study the electron transfer mechanism of RnfG in the context of the complete Rnf complex?

Studying the electron transfer mechanism of RnfG within the complete Rnf complex requires a multi-technique approach:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to monitor flavin redox transitions

    • EPR and ENDOR spectroscopy to characterize the neutral semiquinone intermediate formed during electron transfer

    • Stopped-flow kinetics to measure electron transfer rates

  • Site-Directed Mutagenesis:

    • Creating targeted mutations at the FMN binding site (Thr-175)

    • Modifying residues in the electron transfer pathway

    • Analyzing the impact of mutations on electron transfer efficiency and complex assembly

  • Reconstitution Experiments:

    • Incorporating purified RnfG into proteoliposomes with other Rnf components

    • Measuring electron transfer coupled to ion translocation

    • Determining the directionality of electron flow

  • Structural Analysis:

    • Cryo-EM studies of the intact complex

    • X-ray crystallography of individual components

    • Protein-protein interaction studies to map contact surfaces between RnfG and other subunits

What is the relationship between the RnfG protein and the bioluminescence phenomenon in Photorhabdus luminescens?

The relationship between RnfG and bioluminescence in P. luminescens represents an intriguing research question that bridges electron transport and light production processes:

While direct evidence linking RnfG to bioluminescence is not fully established, there are several potential connections:

  • Redox Balance: As an electron transport protein, RnfG contributes to cellular redox homeostasis, which may indirectly affect the FMNH₂ availability required for the luciferase reaction responsible for bioluminescence.

  • Energy Metabolism Connection: Bioluminescence in P. luminescens is regulated by population density and peaks within days of insect infection . This luminescence requires energy in the form of reduced flavins, and the electron transport function of the Rnf complex may contribute to maintaining the energetic state necessary for sustained light production.

  • Ecological Significance: The bioluminescence of P. luminescens has been shown to deter scavengers from infected insect cadavers, providing protection during the vulnerable developmental stage of the symbiotic nematodes . This suggests a potential evolutionary link between energy metabolism (involving RnfG) and defensive light production.

Research approaches to explore this relationship could include comparative transcriptomics of rnfG expression and luciferase genes under various conditions, along with phenotypic analysis of rnfG mutants for alterations in bioluminescence patterns.

What techniques are most suitable for studying the membrane topology of RnfG in P. luminescens?

The membrane topology of RnfG can be effectively studied using a combination of computational and experimental approaches:

  • Computational Prediction Methods:

    • Hydropathy analysis using algorithms such as TMHMM, HMMTOP, or Phobius

    • Consensus topology prediction using multiple tools

    • Evolutionary analysis to identify conserved residues in transmembrane regions

  • Experimental Validation Techniques:

    • Reporter Protein Fusion Approach: Creating fusion proteins with reporters such as PhoA (alkaline phosphatase) or GFP at various positions. As demonstrated with other Rnf proteins, this approach can determine periplasmic versus cytoplasmic localization of specific domains .

    • Cysteine Scanning Mutagenesis: Introducing cysteine residues at defined positions followed by accessibility labeling with membrane-impermeant reagents.

    • Protease Protection Assays: Limited proteolysis of membrane vesicles to identify protected domains.

  • Validation Through Functional Studies:

    • Confirming that the FMN binding site (Thr-175) is accessible to the periplasmic space, consistent with findings for other Rnf proteins .

    • Comparing experimental results with the topology of homologous proteins from related organisms.

How can researchers effectively generate and characterize site-directed mutants of RnfG to study its function?

Generating and characterizing functional mutants of RnfG requires a systematic approach:

  • Mutant Design Strategy:

    • Focus on the conserved S(T)GAT motif, particularly Thr-175, which is critical for FMN binding

    • Target residues involved in protein-protein interactions within the Rnf complex

    • Create mutations that alter the redox potential of the flavin cofactor

  • Mutation Methods:

    • PCR-based site-directed mutagenesis

    • Gibson assembly for multiple mutations

    • CRISPR-Cas9 for chromosomal modifications in P. luminescens

  • Expression Systems:

    • Heterologous expression in E. coli

    • Homologous expression in P. luminescens

    • Complementation of knockout strains

  • Functional Characterization:

    Mutation TypePrimary AnalysisSecondary AnalysisExpected Outcome for Functional Residues
    FMN binding site (e.g., T175L)UV fluorescence on SDS-PAGEMS analysisLoss of fluorescence, absence of FMN
    Electron transfer pathwaySpectroelectrochemistryEPR of semiquinoneAltered redox potential, changed semiquinone stability
    Membrane integrationMembrane fractionationProtease accessibilityAltered localization pattern
    Protein-protein interactionCo-immunoprecipitationBacterial two-hybridReduced complex formation
  • In vivo Functional Assessment:

    • Growth rates under different conditions

    • Changes in membrane potential

    • Impact on related processes (bioluminescence, antibiotic production)

What approaches should be used to investigate the potential role of RnfG in the symbiotic relationship between P. luminescens and Heterorhabditis nematodes?

Investigating RnfG's role in the P. luminescens-Heterorhabditis symbiosis requires integrative approaches:

  • Genetic Manipulation Strategies:

    • Create rnfG knockout mutants using homologous recombination or CRISPR-Cas9

    • Develop complementation strains expressing wild-type or modified RnfG

    • Establish conditional expression systems to regulate RnfG levels

  • Symbiosis Assessment Methods:

    • Colonization Assays: Quantify bacterial persistence in nematode intestines for mutant vs. wild-type strains

    • Nematode Development Tracking: Assess growth, reproduction, and infective juvenile formation

    • Insect Pathogenicity Tests: Measure virulence using Galleria mellonella or other model insects

    • Co-culture Experiments: Long-term maintenance of the symbiotic relationship in laboratory conditions

  • Physiological Measurements:

    • Energy production capacity (ATP levels)

    • Membrane potential using fluorescent dyes

    • Metabolic profiles during different stages of the symbiotic lifecycle

  • Comparative Analysis:

    • Transcriptomics of rnfG expression during different stages of the symbiotic cycle

    • Proteomics to identify interaction partners specific to the symbiotic state

    • Metabolomics to detect changes in metabolite profiles that might affect nematode development

The relationship between RnfG function and the production of compounds essential for symbiosis (including secondary metabolites that contribute to insect killing, cadaver preservation, and nematode development) would be particularly informative, as P. luminescens is known to produce various antimicrobial compounds that prevent cadaver putrefaction over several weeks .

What are the main technical challenges in studying recombinant RnfG from P. luminescens?

Several technical challenges complicate the study of recombinant RnfG:

  • Membrane Protein Expression Issues:

    • Toxicity to expression hosts due to membrane disruption

    • Protein misfolding and aggregation

    • Inconsistent incorporation of the FMN cofactor

  • Complex Reconstitution Difficulties:

    • The need to co-express multiple Rnf components for functional studies

    • Challenges in maintaining proper stoichiometry of complex components

    • Difficulties in reconstituting the entire complex in artificial membrane systems

  • Functional Assay Limitations:

    • Distinguishing RnfG-specific activity from other electron transfer processes

    • Accurately measuring electron transfer rates in membrane environments

    • Correlating in vitro measurements with in vivo function

  • Structural Analysis Barriers:

    • Maintaining structural integrity during purification

    • Obtaining sufficient quantities of pure, homogeneous protein for crystallization

    • Preserving native conformations in detergent environments

Researchers can address these challenges through:

  • Optimizing expression conditions specifically for flavoproteins

  • Using mild detergents and amphipols for extraction and stabilization

  • Employing nanodiscs or other membrane mimetics for functional reconstitution

  • Developing specialized activity assays that isolate RnfG function

How might RnfG function integrate with other physiological processes in P. luminescens?

RnfG function likely integrates with multiple physiological processes in P. luminescens:

  • Connection to Quorum Sensing: P. luminescens employs LuxS-mediated quorum sensing to regulate various processes . The electron transport function of RnfG may be coordinated with population density through this regulatory network.

  • Relationship with Antibiotic Production: P. luminescens produces several broad-spectrum antibiotics, including a carbapenem-like antibiotic regulated by the cpm gene cluster . Energy requirements for secondary metabolite biosynthesis may link to RnfG-mediated electron transport.

  • Bioluminescence Coordination: The timing of peak bioluminescence (occurring within days of insect infection ) may be energetically supported by electron transport complexes including RnfG.

  • Adaptation to Environmental Transitions: As P. luminescens transitions between the nematode gut and insect hemolymph, it experiences different oxygen tensions and nutrient availabilities, potentially requiring adaptive changes in electron transport chain components like RnfG.

Future research could employ systems biology approaches, including multi-omics integration and metabolic flux analysis, to elucidate how RnfG function is coordinated with these various physiological processes in different stages of the P. luminescens lifecycle.

What are the most promising future research directions for P. luminescens RnfG studies?

The most promising future research directions include:

  • Structural Biology Advancements:

    • Cryo-EM structures of the complete Rnf complex from P. luminescens

    • Comparative structural analysis with homologous complexes from other species

    • Dynamic structural changes during electron transfer

  • Systems-Level Integration:

    • Network analysis connecting RnfG function to global cellular processes

    • Metabolic engineering applications leveraging RnfG's electron transport capabilities

    • Comparative genomics across Photorhabdus species to understand evolutionary adaptations in RnfG

  • Symbiosis Applications:

    • Engineering RnfG variants to enhance symbiotic efficiency

    • Developing biocontrol applications based on optimized energy metabolism

    • Understanding the role of electron transport in host-microbe communication

  • Biotechnological Exploitation:

    • Utilizing the RnfG electron transport mechanism for bioelectrochemical applications

    • Exploring the potential for enhanced bioluminescence through RnfG modification

    • Developing biosensors based on flavin-binding properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.