Recombinant Photorhabdus luminescens subsp. laumondii Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Photorhabdus luminescens subsp. laumondii Fumarate Reductase Subunit C (FrdC)

Photorhabdus luminescens is a Gram-negative bacterium in the Enterobacteriaceae family that lives symbiotically in the intestines of entomopathogenic nematodes . These nematodes seek out and enter insect hosts in the soil . P. luminescens produces toxins and proteins that harm the host after being expelled from the nematode and entering the insect's hemocoel .

Recombinant Photorhabdus luminescens subsp. laumondii Fumarate reductase subunit C (FrdC) is a recombinant protein derived from Photorhabdus luminescens subsp. laumondii . Fumarate reductase is an enzyme complex that functions in anaerobic respiration, enabling the bacteria to use fumarate as a terminal electron acceptor . The subunit C (FrdC) is one of the subunits of this enzyme complex .

Characteristics of FrdC

CharacteristicDescription
Recommended NameFumarate reductase subunit C
Alternative Name(s)Fumarate reductase 15 kDa hydrophobic protein
Gene NamefrdC
Ordered Locus Namesplu4126
AA SequenceMTTKRKPYIRSMAPNWWQKLGFYRFYILRESTAVTTMWFSILLIYGLFALKGGTQSWHEF VTFLQNPVILLVNIITLLGALLHTKTWFELAPKAANIVIKGEKMGSGPVIKLLWAVTIIV TMIILGIALL
Expression Region1-130
Molecular WeightApproximately 15 kDa
SourceE. coli
PurityGreater than 85% as determined by SDS-PAGE
Tag InfoThe tag type is determined during the production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Function and Significance

FrdC is a subunit of the fumarate reductase enzyme, which is essential for anaerobic respiration in Photorhabdus luminescens . Fumarate reductase allows the bacterium to survive in environments with limited oxygen by catalyzing the reduction of fumarate to succinate . This process is vital for energy production under anaerobic conditions .

Applications

ELISA: FrdC can be employed in enzyme-linked immunosorbent assays (ELISA) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; plu4126; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
frdC
Target Protein Sequence
MTTKRKPYIRSMAPNWWQKLGFYRFYILRESTAVTTMWFSILLIYGLFALKGGTQSWHEF VTFLQNPVILLVNIITLLGALLHTKTWFELAPKAANIVIKGEKMGSGPVIKLLWAVTIIV TMIILGIALL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: plu:plu4126

STRING: 243265.plu4126

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Fumarate reductase subunit C (frdC) in Photorhabdus luminescens?

Fumarate reductase subunit C (frdC) in P. luminescens functions primarily as a membrane anchor component of the fumarate reductase complex. This enzyme plays a critical role in anaerobic respiration by catalyzing the conversion of fumarate to succinate as part of the bacterial electron transport chain. In P. luminescens, which colonizes multiple ecological niches including insect larvae, nematode intestines, and soil environments , frdC likely enables metabolic adaptation during transitions between aerobic and microaerobic/anaerobic conditions encountered throughout its complex lifecycle.

The protein typically contains hydrophobic transmembrane domains that anchor the catalytic components (subunits A and B) to the cytoplasmic membrane, facilitating electron transfer from menaquinol to the catalytic site where fumarate reduction occurs. This activity is particularly important during the bacterium's colonization of oxygen-limited environments such as insect hemolymph and tissues.

What is the predicted structure and size of P. luminescens frdC protein?

The P. luminescens frdC protein is predicted to be a relatively small membrane protein of approximately 130 amino acids in length . The protein likely contains multiple transmembrane helices that span the cytoplasmic membrane. Structural prediction analyses suggest the protein adopts a configuration similar to other bacterial frdC proteins, with:

  • 3-4 transmembrane α-helical segments

  • Short hydrophilic loops connecting the transmembrane regions

  • N and C termini positioned on opposite sides of the membrane

  • Conserved residues involved in menaquinone binding

While the exact three-dimensional structure of P. luminescens frdC has not been fully resolved by crystallography, homology modeling based on related bacterial frdC proteins indicates a compact transmembrane structure optimized for anchoring the catalytic components of the fumarate reductase complex to the membrane while facilitating electron transfer.

How does the expression of frdC relate to P. luminescens' lifecycle stages?

The expression of frdC in P. luminescens likely follows patterns similar to other metabolic genes involved in adaptation to changing environmental conditions. Drawing parallels from studies of the mdtABC operon expression in P. luminescens , we can infer that frdC expression is:

  • Upregulated during transition to low-oxygen environments such as insect hemocoel

  • Potentially regulated in response to host factors present in insect tissue

  • Modulated during different phases of bacterial growth

  • Possibly coordinated with expression of other components of the fumarate reductase complex

Research on related genes in P. luminescens has shown site-specific expression patterns during insect colonization . For example, the mdtABC operon exhibits differential expression when P. luminescens colonizes the hematopoietic organ (HO) and midgut of Locusta migratoria and Spodoptera littoralis . Similarly, frdC expression might be upregulated during specific stages of insect colonization when the bacterium encounters oxygen-limited environments.

What are the optimal expression systems for producing recombinant P. luminescens frdC?

Several expression systems can be employed for recombinant production of P. luminescens frdC, each with distinct advantages for different research applications:

E. coli expression system:
The most common approach involves expressing His-tagged frdC in E. coli strains optimized for membrane protein expression . BL21(DE3) derivatives such as C41(DE3) and C43(DE3) are particularly suitable for membrane proteins like frdC. The pET expression system using T7 promoter provides tight regulation and high expression yields.

Recommended expression parameters:

  • Host strain: C41(DE3) or C43(DE3)

  • Vector: pET with N-terminal His-tag

  • Induction: 0.1-0.5 mM IPTG

  • Temperature: 18-20°C post-induction

  • Duration: 16-18 hours

  • Media: Terrific Broth supplemented with 0.5% glucose

Cell-free expression systems:
For functional studies requiring rapid production without cellular toxicity issues, cell-free systems based on E. coli extracts supplemented with detergents or nanodiscs can be employed.

Native expression in P. luminescens:
For studies requiring authentic post-translational modifications or incorporation into native complexes, expression in a modified P. luminescens strain with an inducible promoter may be advantageous, though technically more challenging.

What purification strategy yields the highest purity and stability for recombinant frdC?

Purifying membrane proteins like frdC requires specialized approaches to maintain protein stability and functionality:

Recommended purification protocol:

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation (10,000g, 20 min)

    • Collect membranes by ultracentrifugation (100,000g, 1 hour)

  • Solubilization:

    • Solubilize membranes using mild detergents:

      • n-Dodecyl β-D-maltoside (DDM): 1% w/v

      • Digitonin: 1-2% w/v

      • LMNG (Lauryl Maltose Neopentyl Glycol): 0.5-1% w/v

    • Stir gently for 1-2 hours at 4°C

  • Affinity chromatography:

    • Load solubilized material onto Ni-NTA column

    • Wash with buffer containing low imidazole (20-40 mM) and reduced detergent (0.05% DDM)

    • Elute with buffer containing 250-300 mM imidazole

  • Size exclusion chromatography:

    • Further purify using Superdex 200 in buffer containing 0.03-0.05% DDM

    • Collect fractions containing monomeric protein

  • Stability optimization:

    • Add stabilizing agents:

      • 10% glycerol

      • 1 mM DTT or 5 mM β-mercaptoethanol

      • Appropriate phospholipids (E. coli polar lipid extract, 0.01-0.02 mg/ml)

This protocol typically yields protein with >90% purity suitable for structural and functional studies. The choice of detergent is critical, as inappropriate detergents can lead to protein denaturation or aggregation.

What are the common challenges in expressing membrane proteins like frdC and how can they be overcome?

Expressing membrane proteins like frdC presents several challenges that can be addressed with specific strategies:

ChallengeManifestationSolution Strategy
Toxicity to host cellsPoor growth, plasmid instabilityUse tightly regulated promoters (e.g., pBAD); lower growth temperature to 18-20°C; use specialized strains (C41/C43)
Inclusion body formationInsoluble protein aggregatesReduce expression rate with lower inducer concentration; co-express chaperones (GroEL/ES, DnaK); use fusion partners (MBP, SUMO)
Low yieldInsufficient protein for analysisOptimize codon usage; increase culture volume; use high cell-density fermentation; optimize induction timing
Improper membrane insertionNon-functional proteinInclude signal sequences; use membrane-targeting fusion partners; carefully select detergents during solubilization
Protein instabilityDegradation during purificationIncorporate protease inhibitors; perform all steps at 4°C; minimize purification duration; include stabilizing agents

For P. luminescens frdC specifically, expression can be enhanced by:

  • Reducing incubation temperature to 16-18°C after induction

  • Using 0.1 mM IPTG or 0.02% arabinose (for pBAD systems) to slow expression rate

  • Supplementing media with 5 mM fumarate to potentially stabilize the protein

  • Including 10 mM MgSO₄ in growth media to enhance membrane integrity

What assays can be used to measure the functional activity of recombinant frdC?

Although frdC is a membrane anchor without direct catalytic activity, several approaches can assess its proper folding and ability to form functional complexes:

Reconstitution assays:

  • Co-purify or reconstitute with frdA and frdB subunits (catalytic components)

  • Measure fumarate reduction activity using:

    • Spectrophotometric tracking of electron donor oxidation (NADH or reduced benzyl viologen)

    • Coupled enzyme assays that measure succinate formation

    • Oxygen consumption assays in membrane preparations

Binding assays:

  • Isothermal titration calorimetry (ITC) to measure binding of menaquinone analogs

  • Surface plasmon resonance (SPR) to assess binding to other fumarate reductase subunits

  • Fluorescence-based assays using environmentally sensitive probes attached to quinone analogs

Structural integrity assessments:

  • Circular dichroism (CD) spectroscopy to verify secondary structure (high α-helical content)

  • Thermal shift assays to evaluate protein stability in different detergents

  • Limited proteolysis patterns to confirm proper folding

For functional reconstitution, the most reliable approach is to express and purify all three subunits (frdA, frdB, and frdC) then reconstitute the complex in proteoliposomes. Enzymatic activity can then be assessed by monitoring the reduction of fumarate coupled to oxidation of electron donors.

How can researchers investigate the interaction between frdC and other components of the fumarate reductase complex?

Investigating protein-protein interactions involving membrane proteins requires specialized techniques:

Co-immunoprecipitation and pull-down assays:

  • Express tagged versions of each subunit (His-frdC, Strep-frdA, etc.)

  • Perform pull-down experiments to identify stable complexes

  • Use crosslinking agents like DSS or formaldehyde to capture transient interactions

Bimolecular Fluorescence Complementation (BiFC):

  • Fuse split fluorescent protein fragments to potential interaction partners

  • Monitor reconstitution of fluorescence when proteins interact

  • Particularly useful for visualizing interactions in living bacterial cells

FRET-based interaction assays:

  • Label proteins with appropriate FRET pairs (e.g., CFP/YFP, Alexa488/Alexa546)

  • Measure energy transfer as indicator of proximity and interaction

  • Can be used in detergent solutions or reconstituted liposomes

Chemical crosslinking coupled with mass spectrometry:

  • Use MS-compatible crosslinkers to stabilize complexes

  • Digest crosslinked complexes and identify crosslinked peptides by MS

  • Provides detailed information about interaction interfaces

Nanodiscs and proteoliposomes:

  • Reconstitute components in lipid nanodiscs

  • Analyze composition and stoichiometry using SEC-MALS

  • Assess functional consequences of mutations at predicted interaction sites

These methods can help elucidate how frdC interacts with frdA and frdB, as well as potentially identify interactions with other membrane proteins or components of the electron transport chain in P. luminescens.

How can recombinant frdC be used to study P. luminescens adaptation to different host environments?

Recombinant frdC can serve as a valuable tool for investigating P. luminescens adaptation to various host environments and anaerobic conditions:

Reporter fusion constructs:
Similar to studies with the mdtABC operon , frdC promoter-GFP fusion constructs can be created to monitor expression patterns during host colonization. This approach would allow researchers to:

  • Track frdC expression in different insect tissues

  • Compare expression levels between aerobic and anaerobic conditions

  • Identify environmental signals that trigger expression changes

Site-directed mutagenesis studies:

  • Generate frdC variants with mutations in key residues

  • Introduce these variants into P. luminescens

  • Assess colonization efficiency in different host tissues

  • Measure competitive fitness in mixed infections

Comparative expression analysis:
By combining recombinant frdC expression with transcriptomic approaches, researchers can:

  • Identify co-regulated genes under anaerobic conditions

  • Compare expression patterns in different insect hosts (e.g., Locusta migratoria vs. Spodoptera littoralis)

  • Evaluate the impact of specific host factors on frdC expression

Research has shown that certain P. luminescens genes exhibit tissue-specific expression patterns during insect colonization . For example, the mdtABC operon shows distinct expression in the hematopoietic organ and midgut of infected insects . Similar approaches can be applied to study frdC expression, potentially revealing its role in P. luminescens adaptation to oxygen-limited microenvironments within insect hosts.

What roles might frdC play in P. luminescens virulence and host colonization?

While primarily involved in anaerobic respiration, frdC and the fumarate reductase complex may contribute to P. luminescens virulence and host colonization through several mechanisms:

Metabolic adaptation during infection:

  • Enable bacterial survival in oxygen-limited host tissues

  • Contribute to energy generation during various stages of the infection cycle

  • Support growth using alternative electron acceptors when oxygen is limited

Potential contribution to redox balance:

  • Help maintain redox homeostasis during oxidative stress

  • Potentially contribute to resistance against host immune responses

  • Support bacterial metabolism during dramatic environmental transitions

Possible coordination with virulence factors:
Drawing parallels from studies of the mdtABC efflux pump , frdC expression might be coordinated with virulence factor production. The expression of mdtABC is site-specific during insect colonization , suggesting that metabolic genes and virulence factors may be co-regulated in response to specific host cues.

Research approaches to investigate virulence connections:

  • Create frdC deletion mutants and assess virulence in insect models

  • Perform comparative transcriptomics of wild-type and ΔfrdC strains during infection

  • Investigate potential regulatory connections between frdC and known virulence factors

  • Examine frdC expression in bacterial aggregates within nodules formed during infection

Studies have shown that P. luminescens forms bacterial aggregates and nodule structures during host colonization . Investigating frdC expression within these structures could reveal its contribution to bacterial persistence and proliferation within specific host microenvironments.

How does the structure-function relationship of P. luminescens frdC compare to that of other bacterial species?

Comparative analysis of frdC across bacterial species can provide valuable insights into evolutionary adaptations and functional specializations:

Structural comparisons:

  • Analyze sequence conservation patterns of transmembrane domains

  • Identify P. luminescens-specific residues that may reflect adaptation to its unique lifecycle

  • Compare quinone-binding residues across species from different ecological niches

Functional substitution experiments:

  • Create chimeric proteins with domains from different bacterial species

  • Test ability of heterologous frdC proteins to complement P. luminescens frdC deletion

  • Assess whether P. luminescens frdC can function in other bacterial systems

Evolutionary insights:

  • Investigate whether frdC sequence variation correlates with bacterial lifestyle (free-living, facultative anaerobe, obligate symbiont)

  • Examine potential horizontal gene transfer events in the evolution of the frd operon

  • Compare regulation mechanisms of frdC expression across bacterial species

Suggested experimental approach:

  • Generate a library of recombinant frdC proteins from diverse bacterial species

  • Characterize their biochemical properties in standardized experimental systems

  • Perform complementation assays in P. luminescens frdC knockout strains

  • Correlate functional differences with structural features and ecological adaptations

This comparative approach could reveal how P. luminescens frdC has adapted to support the bacterium's complex lifecycle, which involves transitions between insect pathogenesis and nematode symbiosis - environmental conditions that likely impose unique selective pressures on respiratory systems.

What are the critical quality control checks for recombinant frdC preparations?

Ensuring the quality of recombinant frdC preparations is essential for obtaining reliable experimental results:

Purity assessment:

  • SDS-PAGE with Coomassie staining (target: >90% purity)

  • Western blot using anti-His antibodies to confirm identity

  • Mass spectrometry to verify protein mass and potential modifications

Structural integrity:

  • Circular dichroism spectroscopy to confirm secondary structure (predominantly α-helical)

  • Thermal shift assays to assess stability in different buffer conditions

  • Size exclusion chromatography to check for aggregation or oligomerization

Functional validation:

  • Binding assays with quinone analogs

  • Reconstitution with other fumarate reductase subunits

  • Proteoliposome incorporation efficiency

Critical quality parameters and acceptance criteria:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE>90% single band
IdentityWestern blot/MSCorrect molecular weight and immunoreactivity
MonodispersitySEC>85% in monomeric/proper oligomeric state
Secondary structureCD spectroscopyα-helical content consistent with predictions
Thermal stabilityDSF/nanoDSFTm > 40°C in final storage buffer
Detergent contentColorimetric assayWithin 2-3× CMC of the detergent
Functional activityBinding or reconstitutionDetectable specific activity in functional assays

Remember that membrane proteins are particularly sensitive to preparation conditions. Even subtle variations in purification protocols can significantly impact protein quality and functional activity.

How can researchers optimize detergent selection for frdC solubilization and stability?

Detergent selection is critical for membrane proteins like frdC. A systematic approach includes:

Initial screening protocol:

  • Test a panel of detergents representing different chemical classes:

    • Maltoside-based: DDM, UDM, DM

    • Glucoside-based: OG, NG

    • Neopentyl glycol-based: LMNG, DMNG

    • Fos-choline derivatives: FC-12, FC-14

    • Zwitterionic: LDAO, CHAPS

  • Evaluate extraction efficiency:

    • Solubilize equal amounts of membrane with each detergent

    • Analyze soluble fraction by Western blot

    • Calculate percentage of frdC extracted

  • Assess protein stability in each detergent:

    • Monitor thermal stability using differential scanning fluorimetry

    • Track aggregation propensity over time using dynamic light scattering

    • Evaluate activity retention after storage

Advanced optimization strategies:

  • Test detergent mixtures (e.g., DDM/CHS, LMNG/CHS)

  • Incorporate specific lipids that might stabilize the protein

  • Explore amphipols or SMALPs for detergent-free membrane protein handling

  • Consider nanodiscs for functional studies requiring a lipid bilayer environment

Recommended starting conditions for P. luminescens frdC:
Based on experience with similar membrane proteins, consider initial trials with:

  • DDM (1%) for extraction, reduced to 0.05% for purification steps

  • LMNG (0.1%) as a potentially more stabilizing alternative

  • Digitonin (1%) for applications requiring native-like lipid retention

Monitor protein quality throughout using the quality control metrics outlined in the previous question to objectively determine the optimal detergent system for your specific application.

What strategies are effective for resolving expression and purification challenges specific to P. luminescens proteins?

When working with P. luminescens proteins like frdC, researchers may encounter unique challenges:

Codon optimization strategies:
P. luminescens has a different codon usage bias than common expression hosts:

  • Analyze rare codons in the frdC sequence

  • Generate a codon-optimized synthetic gene for expression

  • Consider using E. coli strains with additional tRNAs for rare codons

Solubility enhancement approaches:

  • Test fusion tags beyond His-tag: MBP, SUMO, or Trx

  • Co-express with bacterial chaperones (GroEL/ES, DnaK/DnaJ)

  • Evaluate expression at different temperatures (16°C, 20°C, 30°C)

P. luminescens-specific considerations:
Drawing parallels from research on other P. luminescens proteins :

  • Some P. luminescens proteins show enhanced expression in the presence of insect tissue extracts

  • Consider testing expression media supplemented with insect hemolymph components

  • Evaluate the impact of growth phase on protein expression, as P. luminescens undergoes phenotypic variation

Purification troubleshooting:

  • If protein aggregates during purification, test different detergent:protein ratios

  • For inconsistent yields, analyze potential proteolytic degradation sites

  • If the protein co-purifies with contaminants, implement additional orthogonal purification steps

Studies on P. luminescens mdtABC expression showed that factors present in insect hematopoietic organ extracts can significantly affect gene expression . Similar approaches might be beneficial when working with recombinant frdC, potentially enhancing expression or stability by mimicking the native host environment.

How might cryo-EM be utilized to elucidate the structure of the complete P. luminescens fumarate reductase complex?

Cryo-electron microscopy represents a powerful approach for structural characterization of membrane protein complexes like fumarate reductase:

Sample preparation considerations:

  • Express and purify all components (frdA, frdB, frdC, and potentially frdD)

  • Reconstitute in amphipols, nanodiscs, or detergent micelles

  • Evaluate sample homogeneity using negative stain EM before cryo-EM

  • Screen multiple conditions to optimize particle distribution and orientation

Data collection and processing strategy:

  • Collect high-resolution data using direct electron detectors

  • Implement motion correction and CTF estimation

  • Perform 2D and 3D classification to identify intact complexes

  • Use focused refinement approaches for flexible regions

  • Consider multibody refinement to characterize dynamic interactions between subunits

Expected insights from structural studies:

Integration with functional studies:

  • Use structure to guide mutagenesis of key residues

  • Combine with computational studies for mechanistic insights

  • Design structure-based inhibitors as potential research tools

The structural information would be particularly valuable for understanding how this complex functions during P. luminescens' transition between aerobic and anaerobic environments during its lifecycle in different host niches .

What role might frdC play in the symbiotic relationship between P. luminescens and nematodes?

P. luminescens maintains a complex symbiotic relationship with entomopathogenic nematodes , and frdC may contribute to this association:

Potential functions in the symbiotic relationship:

  • Support bacterial survival within the nematode gut, where oxygen may be limited

  • Enable metabolic flexibility during transitions between insect and nematode hosts

  • Contribute to energy generation during long-term persistence in the nematode

Research approaches to investigate the symbiotic context:

  • Create frdC knockout or conditional mutants and assess nematode colonization

  • Monitor frdC expression during different stages of the symbiotic cycle

  • Compare frdC expression between symbiotic phase and pathogenic phase

  • Examine whether nematode-derived factors influence frdC expression

Experimental design for studying symbiotic interactions:

  • Generate reporter strains with frdC promoter fusions

  • Monitor expression during nematode colonization

  • Compare expression patterns between free-living bacteria and nematode-associated bacteria

  • Assess the impact of frdC mutation on nematode fitness and reproduction

P. luminescens undergoes phenotypic variation between primary and secondary variants, with different capabilities for nematode support . Investigating whether frdC expression differs between these variants could provide insights into its role in maintaining symbiotic relationships.

How can systems biology approaches integrate frdC function into the broader metabolic network of P. luminescens?

Systems biology offers powerful frameworks for understanding how frdC functions within the broader context of P. luminescens metabolism:

Genome-scale metabolic modeling:

Multi-omics integration approaches:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Map changes in metabolic fluxes during host colonization

  • Identify co-regulated gene clusters that include frdC

  • Discover potential regulatory networks controlling frdC expression

Network analysis applications:

  • Construct protein-protein interaction networks to identify frdC interaction partners

  • Perform comparative network analysis across different growth conditions

  • Identify hub proteins that may coordinate frdC activity with other cellular processes

  • Map potential connections between metabolism and virulence regulation

In silico predictions that can guide experimental design:

  • Predict conditions where frdC becomes essential for bacterial survival

  • Identify potential metabolic bypasses that might compensate for frdC deficiency

  • Suggest unexplored regulatory interactions that merit experimental validation

Similar to studies that have examined site-specific expression of other P. luminescens genes during host colonization , systems biology approaches can help contextualize how frdC contributes to the bacterium's remarkable ability to adapt to diverse ecological niches, from insect pathogen to nematode symbiont .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.