Recombinant Photorhabdus luminescens subsp. laumondii Magnesium transport protein CorA (corA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
corA; plu4635; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
corA
Target Protein Sequence
MLSAFKLENNRLLRLEFEEGEKLSDSLWVDLVEPAEQDRLQVQNELGQILATRPELDDIE
ASARFFEDEDGIHVHSFFYFEDAEDHAGNATVAFTIRDGRLYTLRERELPAFRLYRMRAR
NQTLVDGNAYEVLMDLFETKIEQLADVIENIYSVLESLSRVIMEGKQGDEFDIALSSLAE
QEDISWKVRLCLMDTQRALNFLVRRARLPGAQLEQAREILRDIESLLPHNESLFQKVNFL
MQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELHWTFGYPGAIGLMI
AAGLAPYLYFKRKNWL
Uniprot No.
Target Background
Function
This recombinant Photorhabdus luminescens subsp. laumondii Magnesium transport protein CorA (CorA) mediates the influx of magnesium ions. It also facilitates the uptake of cobalt and manganese ions. The protein functions through an alternating open and closed state mechanism, activated by low cytoplasmic Mg2+ levels and inactivated when cytoplasmic Mg2+ levels are high.
Database Links
KEGG: plu:plu4635
STRING: 243265.plu4635
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
