Recombinant Photorhabdus luminescens subsp. laumondii Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant MalG

Recombinant Photorhabdus luminescens subsp. laumondii Maltose Transport System Permease Protein MalG (MalG) is a bioengineered protein derived from the bacterium Photorhabdus luminescens, a pathogen of insects and occasional human pathogen. MalG functions as a permease in the maltose/maltodextrin transport system, part of an ATP-binding cassette (ABC) transporter complex. The recombinant version is produced in Escherichia coli with an N-terminal His-tag for purification and structural studies .

Structure and Function

MalG (UniProt ID: Q7N983) is encoded by the malG gene (locus plu0460) and spans 296 amino acids (AA). Its structure includes transmembrane domains critical for substrate recognition and transport. As part of the ABC transporter system, MalG interacts with MalF (membrane component) and MalK (ATPase) to mediate maltose uptake .

Production and Purification

The recombinant MalG is expressed in E. coli and purified to >90% homogeneity via SDS-PAGE . Key production parameters include:

Mechanistic Studies

MalG’s role in maltose transport aligns with ABC transporter mechanisms:

  • Maltose Binding: Requires periplasmic maltose-binding protein (MBP) for substrate recognition .

  • ATP Hydrolysis: MalK catalyzes ATP hydrolysis to drive conformational changes in MalF/MalG for transport .

  • Signaling: MBP transmits signals across the membrane via MalF/MalG to activate MalK .

Recombinant MalG enables in vitro reconstitution of the transport complex in proteoliposomes to study ATPase activity and substrate affinity .

Biotechnological Potential

  • Target for Antimicrobials: Inhibiting MalG could disrupt maltose metabolism in P. luminescens, limiting pathogen survival.

  • Protein Engineering: His-tagged MalG facilitates structural studies (e.g., X-ray crystallography) to elucidate transporter dynamics .

Biochemical Properties

PropertyValue/Description
Molecular Weight~32.6 kDa (theoretical) + His-tag (~1–3 kDa)
SolubilityEnhanced by glycerol (50% final concentration recommended)
Thermal StabilityOptimal activity at 28°C (matching P. luminescens growth conditions)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format preferences, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquotation is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
malG; plu0460; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
malG
Target Protein Sequence
MAMVQPKSQKWRLLATHLLMFTFIAMILFPLLMVITISLRPGNFATGSLIPENISWEHWK LALGYSVVSPDGRVTPPPFPVMLWLWNSVKVAFITAVGIVTLSTTCAYAFARMHFRGKST LLKGMLIFQMFPAVLSLVALYALFDRLGEYVPFIGLNTHGGVIFAYLGGIALHVWTIKGY FETIDGSLEEAAALDGATPWQAFRMVLLPLSVPILAVVFILSFIGVITEVPVASLLLRDV NNYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITIVFLVAQRWLVSGLTAGGVKG
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex MalEFGK, which plays a role in maltose/maltodextrin import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: plu:plu0460

STRING: 243265.plu0460

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the maltose transport system permease protein malG in Photorhabdus luminescens?

The maltose transport system permease protein malG in Photorhabdus luminescens subsp. laumondii (strain TT01) is a critical component of the bacterial maltose transport system. It functions as part of a transmembrane channel alongside other proteins like MalF. This system facilitates the transport of maltose and maltodextrins across the bacterial cell membrane, similar to the well-characterized system in E. coli. The protein is encoded by the malG gene (locus tag: plu0460) and has been assigned the UniProt accession number Q7N983 . In E. coli, the maltose transport system consists of a periplasmic maltose-binding protein (MBP), the transmembrane channel (formed by MalF and MalG proteins), and ATPase subunits (MalK) . This sophisticated transport mechanism belongs to the ATP-binding cassette (ABC) transporter family, which uses energy from ATP hydrolysis to transport substrates across membranes.

How does the maltose transport system function in bacteria?

The maltose transport system operates through a sophisticated mechanism that involves multiple proteins working in concert. In the well-studied E. coli system, which likely shares similarities with P. luminescens, the process begins when the periplasmic maltose-binding protein (MBP) captures maltose or maltodextrins in the periplasmic space . Once bound to its substrate, MBP undergoes a conformational change that allows it to interact with the transmembrane complex formed by MalF and MalG proteins .

This interaction triggers a signal that is transmitted to the ATPase subunits (MalK) on the cytoplasmic side of the membrane . The MalK subunits then hydrolyze ATP, providing the energy required for the conformational changes in the transmembrane complex that facilitate the transport of maltose across the membrane and into the cytoplasm . MBP plays a dual role: it not only initiates the transmembrane signaling process but also assists in the alignment and translocation of larger maltodextrin molecules through the channel .

What are the optimal conditions for expressing recombinant malG protein in E. coli?

The expression of recombinant membrane proteins like malG requires careful optimization of multiple variables to achieve high yields of soluble, functional protein. Based on experimental design principles for recombinant protein expression, researchers should consider implementing a multivariant factorial design approach to systematically evaluate the effects of key variables .

A recommended experimental design would include the following variables:

  • Expression strain selection: BL21(DE3), Rosetta, or C41/C43 strains (specialized for membrane proteins)

  • Expression temperature: Test ranges between 16°C and 37°C

  • Induction point: Mid-log phase (OD₆₀₀ 0.6-0.8) versus late-log phase

  • Inducer concentration: For IPTG, test 0.1 mM to 1.0 mM

  • Post-induction time: 4-6 hours versus overnight expression

  • Media formulation: Complex media (LB, TB) versus defined media

  • Additives: Glycerol, sorbitol, or other osmolytes that may enhance protein solubility

  • Aeration conditions: Different agitation rates to optimize oxygen transfer

Rather than testing all possible combinations (which would require 2⁸ = 256 experiments), a fractional factorial design such as a Taguchi array could be implemented to reduce the number of experiments while still capturing significant effects and interactions . This approach has been successfully used to optimize expression conditions for other recombinant proteins, achieving higher productivity with fewer experimental runs .

What methods are most effective for purifying recombinant malG protein while maintaining its functional integrity?

Purification of malG requires specialized protocols due to its hydrophobic transmembrane domains. A systematic purification strategy should include:

  • Membrane fraction isolation:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in buffer containing protease inhibitors

    • Disrupt cells by sonication or pressure homogenization

    • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Detergent screening and solubilization:

    • Test multiple detergents for efficient extraction while maintaining protein stability

    • Recommended detergents: n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin

    • Incubate membrane fraction with selected detergent (typically 1-2% w/v) for 1-2 hours at 4°C with gentle agitation

  • Affinity chromatography:

    • If using a His-tagged construct, use immobilized metal affinity chromatography (IMAC)

    • Equilibrate column with buffer containing 0.02-0.05% detergent

    • Apply solubilized membrane fraction

    • Wash with buffer containing low imidazole concentrations (20-40 mM)

    • Elute with buffer containing high imidazole (250-300 mM)

  • Size exclusion chromatography:

    • Further purify protein by size exclusion chromatography

    • Use buffer containing detergent at concentrations above critical micelle concentration

  • Functional validation:

    • Assess protein functionality through ATPase activity assays or reconstitution into liposomes

For maintaining functional integrity, it is crucial to control temperature (keep at 4°C throughout), add stabilizing agents (glycerol 10-15%), and minimize exposure to harsh conditions. The choice of detergent is particularly critical as it must effectively solubilize the protein while preserving its native conformation.

How can researchers evaluate the functional activity of recombinant malG protein?

Evaluating the functional activity of recombinant malG protein requires assays that assess its ability to participate in maltose transport. Since malG functions as part of a complex with other proteins, comprehensive functional analysis should include:

  • Reconstitution into proteoliposomes:

    • Prepare liposomes from E. coli polar lipid extract or synthetic phospholipids

    • Mix purified malG with other purified components (MalF, MalK) at appropriate ratios

    • Remove detergent using bio-beads or by dialysis to form proteoliposomes

    • Verify incorporation by freeze-fracture electron microscopy or other techniques

  • Transport assays:

    • Encapsulate fluorescent maltose derivatives inside proteoliposomes

    • Measure transport by monitoring changes in fluorescence over time

    • Compare activity with and without ATP to confirm ATP dependence

    • Include appropriate controls (liposomes without protein, heat-inactivated protein)

  • ATPase activity measurements:

    • While malG itself doesn't hydrolyze ATP, the complete transporter complex does

    • Measure ATP hydrolysis using colorimetric assays (malachite green) or coupled enzyme assays

    • Compare basal activity versus stimulated activity in the presence of maltose and maltose-binding protein

  • Binding assays with maltose-binding protein:

    • Use surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure interactions

    • Compare binding affinities with different ligands

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Limited proteolysis to evaluate proper folding

Each assay provides different aspects of functional information, and combining multiple approaches offers a more comprehensive evaluation of protein activity.

How does the malG protein from P. luminescens compare with homologous proteins in other bacterial species?

The maltose transport system in E. coli, which includes the MalF and MalG transmembrane proteins along with the MalK ATPase, has been extensively characterized and serves as a model for understanding ABC transporters . In both organisms, these proteins form a complex that facilitates maltose uptake, with MalF and MalG forming the transmembrane channel and MalK providing energy through ATP hydrolysis .

P. luminescens is an entomopathogenic bacterium that maintains a symbiotic relationship with nematodes and can also cause infections in humans . This dual lifestyle may have driven specific adaptations in membrane transporters, including malG, to function effectively across different host environments and temperature ranges. For instance, some strains of P. luminescens (like TT01-DJC) have temperature-dependent growth limitations that may affect protein expression and functionality .

What role might the malG protein play in the pathogenicity of P. luminescens?

While the direct role of malG in P. luminescens pathogenicity has not been extensively characterized, insights can be drawn from the broader understanding of maltose transport systems and P. luminescens virulence mechanisms.

P. luminescens demonstrates diverse pathogenic activities depending on strain origin and growth conditions . Recent studies have identified human pathogenic strains of P. luminescens, including the Texas strain, which exhibits aggressive colonization of human peripheral blood mononuclear cells (PBMCs) regardless of cell type or growth temperature . This contrasts with P. asymbiotica strains, which show more selective cell type interactions .

Nutrient acquisition systems, including carbohydrate transporters like the maltose transport system, are often important virulence factors in bacterial pathogens. The maltose transport system may contribute to P. luminescens pathogenicity in several ways:

  • Nutritional adaptation: Efficient uptake of maltose and maltodextrins could provide a competitive advantage during infection, particularly in nutrient-limited environments.

  • Temperature adaptation: Different P. luminescens strains show varying abilities to grow at mammalian body temperature (37°C) . The functionality of membrane proteins like malG at different temperatures may influence the ability of certain strains to establish human infections.

  • Immune evasion: Some bacterial transporters can contribute to resistance against host antimicrobial peptides or other defense mechanisms.

  • Biofilm formation: Polysaccharide metabolism, which involves maltose-related pathways, can affect biofilm formation, a process relevant to bacterial persistence during infection.

Further research using gene deletion mutants and complementation studies would be necessary to definitively establish the contribution of malG to P. luminescens pathogenicity.

What are the current challenges and limitations in structural studies of membrane proteins like malG?

Structural characterization of membrane proteins like malG presents significant challenges due to their hydrophobic nature and requirement for a lipid environment. Current limitations and potential solutions include:

  • Protein expression and purification challenges:

    • Membrane proteins often express at low levels and can be toxic to host cells

    • Solution: Use specialized expression strains like C41/C43 (designed for membrane proteins) and inducible promoters with tight regulation

    • Detergent selection is critical and must balance efficient extraction with maintaining protein stability and native conformation

  • Crystallization difficulties:

    • The presence of detergent micelles complicates crystal formation and affects diffraction quality

    • Solution: Screen multiple detergents and use techniques like lipidic cubic phase crystallization or the addition of antibody fragments to provide crystal contacts

  • Conformational heterogeneity:

    • Membrane transporters like malG exist in multiple conformational states as part of their transport cycle

    • Solution: Use mutations, inhibitors, or nanobodies to lock the protein in specific conformations

  • Alternative structural methods:

    • Beyond X-ray crystallography, techniques like cryo-electron microscopy (cryo-EM) have revolutionized membrane protein structural biology

    • Solution: For proteins like malG that may be part of larger complexes, cryo-EM might be advantageous

    • NMR studies for specific domains or segments can provide complementary information about dynamics

  • Functional validation of structures:

    • Ensuring that structures represent functionally relevant states requires careful biochemical and biophysical validation

    • Solution: Combine structural studies with functional assays and molecular dynamics simulations

  • Reconstitution systems:

    • Creating suitable membrane-mimetic environments that maintain protein functionality is challenging

    • Solution: Nanodiscs, amphipols, and styrene-maleic acid copolymer lipid particles (SMALPs) offer alternatives to traditional detergent micelles

Recent advances in membrane protein structural biology, particularly the "resolution revolution" in cryo-EM, offer promising approaches for future studies of complex membrane transporters like the maltose transport system.

What statistical approaches are recommended for analyzing experimental data on malG protein expression?

For rigorous analysis of experimental data on malG protein expression, researchers should implement statistical approaches that account for multiple variables and their interactions. Based on established experimental design principles, the following statistical methods are recommended:

  • Factorial analysis of variance (ANOVA):

    • Appropriate for experimental designs with multiple factors

    • Allows identification of statistically significant main effects and interactions

    • Can quantify the relative contribution of each factor to the observed variation in protein expression

  • Response surface methodology (RSM):

    • Useful for optimizing expression conditions after identifying significant factors

    • Creates mathematical models that predict protein expression levels based on experimental variables

    • Helps identify optimal conditions through visualization of response surfaces

  • Multivariate analysis:

    • Principal Component Analysis (PCA) or Partial Least Squares (PLS) can help identify patterns in complex datasets

    • Particularly useful when analyzing multiple response variables (e.g., protein yield, solubility, activity)

  • Design of Experiments (DoE) analysis:

    • Fractional factorial designs, like the Taguchi method, require specific analytical approaches

    • Level averages analysis helps identify optimal factor levels while minimizing the number of experiments

    • Provides a systematic method for evaluating main effects when using reduced experimental matrices

For example, when optimizing expression conditions using a fractional factorial design, researchers should calculate the average response for each level of each factor and identify the combination of factor levels that maximizes the desired response (e.g., soluble protein yield) . Statistical significance can be assessed using ANOVA, with post-hoc tests to identify specific differences between factor levels.

The table below illustrates how level averages might be calculated for a malG expression optimization experiment using a Taguchi L9 orthogonal array:

FactorLevel 1 AverageLevel 2 AverageLevel 3 AverageOptimal LevelContribution
Temperature24.3 mg/L68.5 mg/L45.2 mg/LLevel 244.2
IPTG conc.32.1 mg/L51.4 mg/L54.5 mg/LLevel 322.4
Medium38.7 mg/L50.6 mg/L48.7 mg/LLevel 211.9
Induction time42.3 mg/L49.8 mg/L45.9 mg/LLevel 27.5

How can researchers address data inconsistencies in functional studies of membrane transporters?

Functional studies of membrane transporters like malG often yield inconsistent results due to the complexity of these systems. Researchers can address these inconsistencies through a structured approach:

  • Systematic troubleshooting and validation:

    • Verify protein integrity by SDS-PAGE and Western blotting before functional assays

    • Confirm proper reconstitution into membrane systems using multiple techniques

    • Test activity under a range of conditions to identify potential inhibitors or activators

  • Control for experimental variables:

    • Standardize protein:lipid ratios in reconstitution experiments

    • Control detergent concentration carefully, especially in activity assays

    • Consider the influence of buffer composition, pH, and temperature on activity measurements

  • Statistical approaches to variability:

    • Implement robust statistical methods (e.g., bootstrapping, permutation tests)

    • Use mixed-effects models to account for batch-to-batch variation

    • Identify and remove outliers based on objective criteria (e.g., Grubbs' test)

  • Cross-validation with multiple assay types:

    • Compare results from different functional assays measuring complementary aspects of activity

    • Validate transport activity using both direct and indirect methods

    • Correlate functional data with structural or biophysical characteristics

  • Data normalization strategies:

    • Express activity relative to a well-characterized control

    • Normalize for protein amount and orientation in reconstituted systems

    • Consider activity per unit of properly folded protein rather than total protein

  • Addressing reconstitution heterogeneity:

    • Use techniques like fluorescence correlation spectroscopy to quantify protein incorporation

    • Implement density gradient centrifugation to isolate homogeneous proteoliposome populations

    • Consider single-vesicle techniques to characterize heterogeneity in transport activity

By systematically addressing these aspects, researchers can improve data consistency and develop a more accurate understanding of malG function within the maltose transport system.

What emerging technologies could advance our understanding of malG function and structure?

Several cutting-edge technologies hold promise for deepening our understanding of the structure-function relationships in membrane proteins like malG:

  • Cryo-electron microscopy (cryo-EM) advances:

    • Single-particle cryo-EM now achieves near-atomic resolution for membrane proteins

    • Time-resolved cryo-EM could potentially capture different conformational states during the transport cycle

    • This approach could reveal how malG changes conformation during maltose transport

  • Integrative structural biology:

    • Combining multiple techniques (X-ray crystallography, cryo-EM, NMR, mass spectrometry)

    • Cross-linking mass spectrometry (XL-MS) to identify protein-protein interactions between malG and other components

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

  • Advanced membrane mimetics:

    • Nanodiscs with controlled lipid composition to study lipid-protein interactions

    • Cell-free expression systems combined with artificial membranes

    • Microfluidic systems for high-throughput screening of stabilizing conditions

  • In silico approaches:

    • Molecular dynamics simulations across longer timescales to model complete transport cycles

    • Machine learning for structure prediction (building on AlphaFold/RoseTTAFold advances)

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to study substrate interactions

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to track conformational changes in real-time

    • Single-molecule force spectroscopy to measure energetics of transport

    • High-speed atomic force microscopy (HS-AFM) to visualize conformational dynamics

  • Genetic and genomic approaches:

    • CRISPR-Cas9 genome editing to study malG variants in the native context

    • Deep mutational scanning to comprehensively map structure-function relationships

    • Synthetic biology approaches to create minimal transporters with defined components

The application of these technologies to malG research could provide unprecedented insights into the mechanisms of maltose transport and the roles of individual components in the transport complex.

How might research on malG contribute to broader understanding of bacterial adaptation and pathogenesis?

Research on the maltose transport system permease protein malG has implications that extend beyond understanding a single protein's function to broader concepts in bacterial adaptation and pathogenesis:

  • Temperature adaptation mechanisms:

    • P. luminescens strains show varying abilities to grow at different temperatures, with some strains unable to grow at 37°C

    • Studying how membrane proteins like malG maintain functionality across temperature ranges could reveal adaptation mechanisms that enable bacterial survival in diverse environments

    • This could provide insights into how environmental bacteria evolve to become human pathogens

  • Host-pathogen interactions:

    • Recent research has identified novel human pathogenic strains of P. luminescens with unique interaction patterns with human immune cells

    • Understanding how nutrient acquisition systems like the maltose transporter contribute to bacterial survival during infection could reveal new aspects of bacterial pathogenesis

    • The Texas strain of P. luminescens shows aggressive colonization of all human PBMC cell types, unlike the more selective P. asymbiotica strains

  • Bacterial evolution and horizontal gene transfer:

    • Comparative genomics of maltose transport systems across bacterial species could reveal patterns of horizontal gene transfer and convergent evolution

    • Identifying signature adaptations in transporters from different ecological niches could help predict potential emerging pathogens

  • Antimicrobial resistance mechanisms:

    • Membrane transporters can contribute to antimicrobial resistance through efflux mechanisms

    • Research on malG structure and function could inform the development of inhibitors targeting bacterial nutrient acquisition systems

    • Understanding how bacteria regulate transporter expression in response to environmental challenges could reveal potential vulnerabilities

  • Bacterial physiology and metabolism:

    • The maltose transport system connects environmental sensing, nutrient acquisition, and energy metabolism

    • Systems biology approaches integrating transporter function with metabolic networks could provide a more comprehensive understanding of bacterial adaptation

The insights gained from malG research could contribute to the development of novel antimicrobial strategies targeting nutrient acquisition systems, particularly for pathogens that have evolved from environmental bacteria, such as P. luminescens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.