Recombinant Photorhabdus luminescens subsp. laumondii Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the protein with your specified tag.
Synonyms
nqrE; plu1200; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
nqrE
Target Protein Sequence
MEHFISLFVRAVFIENMALAFFLGMCTFLAVSKNVTTAFGLGIAVTVVLGISVPANNLVY NLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVNC AIFGGVSFMAQRDYNFSESIVYGFGSGIGWMLAIVLLASIREKMKYADVPAGLKGLGITF VTTGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol in two sequential reactions. This process is coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: plu:plu1200

STRING: 243265.plu1200

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Photorhabdus luminescens in research contexts?

Photorhabdus luminescens is a Gram-negative luminescent enterobacterium that exists in a mutualistic symbiotic relationship with soil nematodes of the Heterorhabditidae family, specifically Heterorhabditis bacteriophora. This bacterium exhibits a complex life cycle consisting of both a symbiotic phase (colonizing the nematode gut) and a pathogenic phase (infecting insect larvae). During the pathogenic phase, P. luminescens is released from the nematode into the insect hemocoel, where it proliferates rapidly and produces toxins that typically kill the insect host within 48-72 hours . The bacterium's remarkable ability to transition between hosts makes it an excellent model organism for studying host-pathogen interactions, bacterial adaptation mechanisms, and electron transport systems that may function differently depending on environmental conditions .

How does NADH-quinone reductase function in bacterial systems?

NADH-quinone reductase (NDH) functions as a crucial component of the bacterial respiratory chain, catalyzing the transfer of electrons from NADH to quinone while simultaneously translocating ions across the membrane. In many bacteria, including P. luminescens, NDH-1 specifically translocates protons, contributing to the electrochemical gradient that drives ATP synthesis. The enzyme consists of peripheral domains responsible for electron transfer through a series of iron-sulfur clusters and membrane domains involved in ion translocation . The electron transfer pathway proceeds from NADH through a chain of iron-sulfur clusters to the final acceptor, quinone. This creates the proton-motive force necessary for energy production, making the enzyme essential for bacterial bioenergetics and survival .

What distinguishes Na(+)-translocating NADH-quinone reductase from standard NDH complexes?

While standard NDH complexes (such as NDH-1 in E. coli) primarily translocate protons, Na(+)-translocating NADH-quinone reductase (NQR) systems specifically pump sodium ions across the membrane. This key distinction affects not only the bioenergetics of the organism but also its ecological adaptations, particularly in environments where sodium gradient formation may be advantageous. NQR typically consists of six subunits (NqrA-F), with NqrE serving as one of the membrane-embedded components involved in sodium translocation . The presence of a sodium-pumping complex in P. luminescens likely represents an adaptation to its complex lifecycle, potentially providing advantages during transitions between insect and nematode hosts where ion concentrations may vary significantly.

What are the optimal expression systems for recombinant production of P. luminescens nqrE?

For recombinant production of P. luminescens subsp. laumondii Na(+)-translocating NADH-quinone reductase subunit E (nqrE), E. coli expression systems typically yield the best results, particularly when using vectors with inducible promoters like pET or pBAD systems. When expressing membrane proteins like nqrE, E. coli strains C41(DE3) or C43(DE3), which are engineered for membrane protein expression, can significantly improve yields by mitigating toxicity issues. Expression should be conducted at lower temperatures (16-25°C) after induction to facilitate proper folding, with optimal results typically achieved with extended expression periods (16-24 hours). IPTG concentrations should be kept low (0.1-0.5 mM) to prevent formation of inclusion bodies. Incorporating a polyhistidine tag at either the N- or C-terminus facilitates subsequent purification while minimizing impact on protein function .

What purification strategy yields the highest purity of functional nqrE protein?

A multi-step purification approach is required to obtain high-purity, functional nqrE protein. After cell lysis, membrane fractions should be isolated by ultracentrifugation (typically 100,000 × g for 1 hour) and subsequently solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.5-1% concentration. For affinity chromatography, Ni-NTA resin is recommended for His-tagged constructs, with stringent washing using 20-40 mM imidazole to remove non-specific binding proteins. Following elution, ion exchange chromatography using Q-Sepharose offers further purification, employing a 15-35% linear gradient of NaCl for elution . Size exclusion chromatography as a final step ensures removal of aggregates and provides buffer exchange opportunities. Throughout the purification process, maintain detergent concentrations above critical micelle concentration to prevent protein aggregation, and include glycerol (10%) and protease inhibitors to enhance stability .

How can researchers confirm proper folding and functionality of recombinant nqrE?

Confirming proper folding and functionality of recombinant nqrE requires a multi-faceted approach. Circular dichroism (CD) spectroscopy should be employed to assess secondary structure elements, while thermal shift assays can evaluate protein stability. Functional assessment should include NADH oxidation activity measurements using NADH-K₃Fe(CN)₆ reductase assays, where conversion of NADH to NAD⁺ can be monitored spectrophotometrically at 340 nm . Additionally, sodium transport capability can be measured using sodium-sensitive fluorescent dyes or by reconstituting the protein into liposomes and measuring sodium flux. For comprehensive structural validation, limited proteolysis patterns compared with native protein can confirm correct folding. When possible, incorporation of the purified subunit into complete NQR complex followed by electron paramagnetic resonance (EPR) spectroscopy provides definitive evidence of proper integration and functional electron transfer capabilities .

What are the key structural features of nqrE that determine its role in sodium translocation?

The nqrE subunit contains multiple transmembrane helices that form part of the sodium translocation pathway within the NQR complex. Key structural features include conserved polar residues within the transmembrane domains that create a hydrophilic channel for sodium ions, particularly conserved aspartate or glutamate residues that likely coordinate sodium ions during transport. The protein contains strategic charged residues at the interface between the membrane and cytoplasm/periplasm that may serve as entry/exit points for sodium ions. While we lack a crystal structure specifically for P. luminescens nqrE, comparative modeling with related proteins suggests the presence of a quinone-binding site that links electron transfer to sodium movement. The structural arrangement likely allows for conformational changes during the catalytic cycle that alternately expose sodium-binding sites to either side of the membrane, facilitating directional transport coupled to electron transfer from NADH to quinone .

How does electron transfer couple with sodium translocation in the NQR complex?

Electron transfer in the NQR complex proceeds from NADH through a series of cofactors including FAD, iron-sulfur clusters, and FMN, before ultimately reducing quinone. This electron pathway creates conformational changes in the protein complex that drive sodium translocation. Similar to the mechanism observed in related systems, the nqrE subunit likely participates in a conformational cycle where electron transfer to specific redox centers triggers structural rearrangements that alter the affinity and accessibility of sodium binding sites . The precise coupling mechanism involves sequential reduction of cofactors, with each electron transfer event driving partial steps in the sodium pumping process. Based on studies of similar systems, it's likely that the complete NQR complex in P. luminescens translocates approximately 2 Na⁺ ions per NADH oxidized, with nqrE playing a crucial role in this coupling process by housing key sodium-coordinating residues that undergo conformational changes in response to the redox state of nearby cofactors .

What spectroscopic methods are most effective for analyzing the redox centers in recombinant nqrE?

For comprehensive analysis of redox centers in recombinant nqrE and the complete NQR complex, electron paramagnetic resonance (EPR) spectroscopy represents the gold standard. EPR can detect and characterize paramagnetic species including iron-sulfur clusters and flavin semiquinones in their native state . X-ray absorption spectroscopy (XAS) provides complementary information about metal coordination environments within the protein. UV-visible spectroscopy offers a straightforward approach for initial characterization, as flavin cofactors exhibit characteristic absorption patterns that change upon reduction. For kinetic studies, stopped-flow spectroscopy coupled with rapid freeze-quench techniques can capture transient intermediates in the electron transfer pathway. Resonance Raman spectroscopy is particularly valuable for examining flavin environments and their changes during the catalytic cycle. When combined, these approaches provide a comprehensive view of the redox centers, with EPR spectroscopy being particularly informative for detecting signals from [4Fe-4S] clusters similar to those seen in related bacterial systems like the NuoI subunit of E. coli NDH-1 .

How is nqrE gene expression regulated during the host invasion process of P. luminescens?

The expression of nqrE in P. luminescens is likely regulated as part of a coordinated response during the transition between hosts and environmental conditions. Based on studies of gene expression in P. luminescens during insect infection, the nqr operon would be expected to show differential regulation as the bacterium transitions from the nematode gut to the insect hemocoel . This regulation likely involves sensing environmental signals including temperature, oxygen levels, and nutrient availability. Research on related genes in P. luminescens demonstrates that many virulence and metabolic genes are upregulated upon insect infection, with evidence of temperature-dependent expression patterns at 28°C versus 37°C . The regulation system likely involves global regulators responsive to environmental cues, potentially including two-component signal transduction systems that are well-documented in P. luminescens adaptation to different hosts. Experimental approaches using reporter constructs similar to those employed with mCherry in P. luminescens can provide insights into the temporal and spatial expression patterns of nqrE during host colonization and infection processes .

What promoter elements control nqrE expression in different environmental conditions?

The promoter region controlling nqrE expression likely contains multiple regulatory elements responsive to different environmental conditions encountered during the P. luminescens lifecycle. Based on studies of other P. luminescens genes induced upon insect infection, the nqrE promoter may contain binding sites for transcription factors responsive to temperature shifts, oxygen limitation, and host-derived signals . Specifically, the promoter might include binding sites for global regulators like FNR (responding to oxygen limitation), CRP (responding to carbon source availability), and specific two-component response regulators. Temperature-responsive elements similar to those in other genes differentially expressed between 28°C (insect temperature) and 37°C (mammalian temperature) may be present . Potential structural features could include -10 and -35 sequences with suboptimal spacing, allowing for regulation by multiple factors. Experimental mapping through 5' RACE analysis, promoter-reporter fusions, and chromatin immunoprecipitation (ChIP) approaches would be necessary to definitively characterize these regulatory elements and their functions in different environmental contexts.

How do mutations in the nqr operon affect P. luminescens viability in different host environments?

Mutations in the nqr operon, particularly in the nqrE gene, likely produce differential effects on P. luminescens viability depending on the host environment. In the oxygen-limited environment of the insect hemocoel, disruption of the Na⁺-translocating NADH-quinone reductase system would significantly impact energy generation and bacterial survival, particularly if alternative respiratory pathways are downregulated in this condition. The severity of the effect would depend on whether P. luminescens possesses functional alternative respiratory complexes like NDH-1 that could partially compensate for NQR loss . In the nematode gut environment, where different nutritional and oxygen conditions exist, the phenotypic consequences might differ significantly. Research on other bacterial systems indicates that mutations affecting respiratory chain components often demonstrate host-specific fitness defects. Experimental approaches should involve creating targeted knockout mutants and assessing bacterial load, persistence, and virulence in both insect models and nematode colonization assays. Complementation studies would confirm phenotype specificity, while competition assays between wild-type and mutant strains would quantify the relative fitness impact across different host environments .

How can site-directed mutagenesis of conserved residues in nqrE elucidate the sodium translocation mechanism?

Site-directed mutagenesis of conserved residues in nqrE provides a powerful approach to dissect the sodium translocation mechanism. Strategic targets for mutation include conserved polar residues within transmembrane domains, particularly aspartate, glutamate, and asparagine residues that may coordinate sodium ions. Alanine scanning mutagenesis of these residues followed by functional assays can identify essential sodium-binding sites. Conservative mutations (e.g., Asp to Glu or Asn) versus non-conservative changes can distinguish between residues involved in sodium coordination versus structural roles . Mutations in the putative quinone-binding region can help elucidate coupling between electron transfer and sodium movement. After generating mutants, researchers should assess both electron transfer activity (NADH:quinone oxidoreductase activity) and sodium pumping ability (using sodium-sensitive fluorescent dyes or ²²Na⁺ transport assays). Critical residues can be further characterized through pH-dependence studies to identify potential protonation events in the transport cycle. Finally, double mutant cycle analysis between residues predicted to interact during conformational changes can reveal cooperative effects essential for the transport mechanism .

What are the approaches for reconstituting functional nqrE into liposomes for biophysical studies?

Reconstituting functional nqrE into liposomes for biophysical studies requires a specialized approach to maintain protein stability and functionality. Begin with purified nqrE in detergent solution, selecting mild detergents like DDM or LMNG that preserve membrane protein structure . Prepare liposomes using a lipid composition mimicking bacterial membranes (typically a mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at a 7:2:1 ratio) through extrusion to generate unilamellar vesicles of defined size (100-200 nm diameter). For reconstitution, mix protein and liposomes at a lipid-to-protein ratio of 100:1 to 50:1, followed by controlled detergent removal using Bio-Beads SM-2 or through dialysis against detergent-free buffer containing 150 mM NaCl, 50 mM Tris-HCl pH 7.5, and 5% glycerol. Confirm successful reconstitution through freeze-fracture electron microscopy, dynamic light scattering, and proteoliposome flotation assays. For functional studies, establish an ion gradient across the liposome membrane and assess sodium transport using either ²²Na⁺ radioisotope flux measurements or sodium-sensitive fluorescent dyes like SBFI. Advanced biophysical studies may include solid-state NMR to examine protein dynamics or surface-enhanced infrared absorption spectroscopy to monitor conformational changes during the transport cycle .

How can cryo-electron microscopy be optimized for structural determination of the complete NQR complex containing nqrE?

Optimizing cryo-electron microscopy (cryo-EM) for structural determination of the complete NQR complex requires addressing several technical challenges specific to membrane protein complexes. Initial purification should employ amphipols (particularly A8-35) or nanodiscs as alternatives to detergent micelles, as they provide more native-like environments and enhance particle visibility in cryo-EM. Sample homogeneity is critical and can be improved through gradient ultracentrifugation or size exclusion chromatography immediately before grid preparation . Grid preparation should test multiple parameters including sample concentration (typically 0.5-3 mg/ml), grid types (Quantifoil R1.2/1.3 or UltrAuFoil), and glow discharge conditions to minimize preferred orientation issues common with membrane proteins. Apply the protein sample to grids at controlled temperature and humidity (4°C, ~95% humidity) to prevent protein denaturation at the air-water interface. During image acquisition, employ strategies to address beam-induced movement, including the use of energy filters and collecting dose-fractionated movie frames. For data processing, implement 3D classification approaches to separate different conformational states that may be present due to the dynamic nature of the transport cycle. Computational approaches like symmetry expansion or focused refinement may help resolve local features of nqrE within the larger complex context .

What ecological advantages does Na⁺-translocating NADH-quinone reductase provide to P. luminescens in its lifecycle?

The Na⁺-translocating NADH-quinone reductase likely confers several ecological advantages to P. luminescens throughout its complex lifecycle. In the oxygen-limited environment of the insect hemocoel, Na⁺-based bioenergetics may provide more efficient energy conversion than proton-based systems, particularly when pH gradients are difficult to maintain . The sodium-pumping capability may enable P. luminescens to rapidly establish electrochemical gradients necessary for nutrient transport and energy generation during the critical early stages of insect infection, contributing to its ability to kill insect hosts within 48-72 hours . During transitions between nematode and insect hosts, the different ion composition and pH conditions encountered may favor sodium-coupled energy generation in specific phases of the lifecycle. Additionally, sodium ion cycles may facilitate adaptation to varying salt concentrations encountered in soil environments where the bacterium-nematode complex resides. The NQR system may also contribute to pathogenicity by supporting the high energy demands required for toxin production, as P. luminescens produces numerous virulence factors upon insect infection . The presence of this specialized respiratory system likely represents an important adaptation supporting the bacterium's success as both a mutualistic symbiont and a lethal insect pathogen.

How have evolutionary pressures shaped the structure and function of nqrE in the context of host-pathogen interactions?

Evolutionary analysis of nqrE reveals how selective pressures associated with the dual lifestyle of P. luminescens have shaped this protein's structure and function. The symbiotic relationship with nematodes combined with pathogenic interactions with insects has likely selected for versatile energy generation systems capable of functioning in diverse host environments . Comparative genomic analysis would likely show evidence of purifying selection maintaining key functional residues involved in sodium binding and quinone interaction, while allowing diversification in regions interacting with host-specific factors. The nqrE gene may show evidence of horizontal gene transfer events, as respiratory chain components are often subject to lateral genetic exchange providing rapid adaptation to new ecological niches. Selection pressures related to temperature adaptation would be particularly evident, as P. luminescens must function efficiently at both insect temperatures (~28°C) and potentially mammalian temperatures during opportunistic infections (~37°C) . Furthermore, coevolution analysis between nqrE and other NQR subunits would likely reveal coordinated evolution maintaining critical interfaces for complex assembly and function. Signatures of selection may differ between P. luminescens strains with varying host ranges, potentially correlating with their capacity to infect different insect species or ability to cause opportunistic human infections, as seen with P. asymbiotica .

What experimental design best addresses the temperature-dependent functionality of nqrE?

A comprehensive experimental design for investigating temperature-dependent functionality of nqrE should integrate biochemical, biophysical, and in vivo approaches. Begin with parallel protein expression at multiple temperatures (18°C, 28°C, and 37°C) to assess how temperature affects proper folding and incorporation of cofactors. Purify the protein from each condition and conduct thermal stability assays using differential scanning fluorimetry to generate thermal denaturation profiles. Enzyme kinetics measurements should compare NADH oxidation and quinone reduction rates across a temperature range (10-45°C) to determine temperature optima and calculate activation energies through Arrhenius plots . For biophysical characterization, employ temperature-controlled EPR spectroscopy to examine how cofactor environments respond to temperature changes. In vivo approaches should include construction of reporter strains where nqrE expression is linked to fluorescent proteins, allowing real-time monitoring of expression changes during temperature shifts . Complementary transposon mutagenesis screens at different temperatures can identify genetic interactions specific to certain thermal environments. Finally, functional reconstitution of the NQR complex in liposomes followed by sodium transport measurements at various temperatures will directly assess how temperature affects the coupling between electron transfer and ion translocation .

Temperature (°C)Specific Activity (μmol NADH/min/mg)Na⁺ Transport Rate (nmol/min/mg)Thermal Stability T₅₀ (°C)
150.42 ± 0.053.1 ± 0.438.2 ± 0.8
251.35 ± 0.129.4 ± 0.837.9 ± 0.6
282.24 ± 0.1815.7 ± 1.237.5 ± 0.7
371.87 ± 0.2210.2 ± 1.536.1 ± 0.9
420.76 ± 0.144.3 ± 0.932.3 ± 1.2

Table 1: Hypothetical temperature-dependence profile of recombinant P. luminescens NQR complex containing nqrE. Values represent activity, transport rates, and stability at different temperatures relevant to the organism's lifecycle.

How can isotope labeling be utilized to track sodium translocation in the nqrE-containing complex?

Isotope labeling provides powerful approaches for tracking sodium translocation in the nqrE-containing complex. ²²Na⁺ radioisotope flux measurements represent the gold standard, where proteoliposomes containing reconstituted NQR complex are loaded with non-radioactive sodium buffer, then exposed to ²²Na⁺ in the external medium. Time-dependent uptake can be measured by filtering liposomes and quantifying accumulated radioactivity, providing direct evidence of sodium transport . Complementary approaches include ²³Na-NMR spectroscopy with shift reagents to distinguish internal from external sodium populations, allowing real-time monitoring of transport without filtration steps. For structural insights, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions experiencing conformational changes during the transport cycle, particularly when performed under conditions promoting different states of the transport cycle. Neutron reflectometry with deuterated phospholipids can characterize structural changes at the membrane interface during transport. Inside-out membrane vesicles prepared from bacteria expressing the NQR complex can be used for transport studies under more native conditions. Finally, correlating ²²Na⁺ transport with simultaneous measurement of electron transfer (monitoring NADH oxidation spectrophotometrically) can establish the Na⁺/electron stoichiometry, which is a fundamental characteristic of the coupling mechanism .

What are the critical considerations when designing inhibitor studies targeting nqrE function?

Designing effective inhibitor studies targeting nqrE function requires careful consideration of several critical factors. Begin by selecting chemically diverse inhibitor candidates based on rational design approaches targeting known functional domains in nqrE, particularly the quinone-binding site and regions involved in conformational changes during the transport cycle. Structure-activity relationship (SAR) studies should systematically modify inhibitor scaffolds to identify essential pharmacophore features . Assay development must include both enzyme activity measurements (NADH:quinone oxidoreductase activity) and direct sodium transport assays to distinguish between inhibitors affecting electron transfer versus those specifically disrupting sodium translocation. Selectivity profiling against related respiratory enzymes (particularly NDH-1) is essential to identify nqrE-specific inhibitors. Binding studies using microscale thermophoresis or isothermal titration calorimetry should determine binding kinetics and thermodynamics. For promising candidates, photoaffinity labeling can identify precise binding sites when combined with mass spectrometry analysis. In vivo validation should assess growth inhibition under conditions where the NQR complex is essential, comparing effects in wild-type and nqrE-deficient strains. Finally, crystallography or cryo-EM with bound inhibitors provides structural insights into inhibition mechanisms, while molecular dynamics simulations can reveal how inhibitors disrupt conformational changes necessary for sodium translocation .

What insights could single-molecule techniques provide about nqrE conformational dynamics?

Single-molecule techniques offer unprecedented insights into nqrE conformational dynamics by revealing behaviors masked in ensemble measurements. Single-molecule FRET (smFRET) can track real-time conformational changes by strategically placing fluorophore pairs on purified nqrE or the complete NQR complex reconstituted into nanodiscs or liposomes . This approach can directly correlate sodium binding events with specific conformational states, particularly when combined with simultaneous electrical recording in a supported lipid bilayer setup. Single-molecule force spectroscopy using atomic force microscopy can measure the energetics of conformational transitions and identify energy barriers in the transport cycle. High-speed atomic force microscopy (HS-AFM) provides direct visualization of structural dynamics in the membrane environment at near-atomic resolution and millisecond timescale. For functional insights, single-enzyme activity assays monitoring NADH oxidation through fluorescence can reveal heterogeneity in enzyme populations and identify transient catalytic states. Combining these approaches with controlled manipulation of sodium concentrations, membrane potential, and substrate availability will map how these factors influence the conformational landscape. These studies would likely reveal the stochastic nature of sodium pumping events, potential conformational substates, and rate-limiting steps in the transport cycle that are inaccessible through conventional ensemble approaches .

How can systems biology approaches integrate nqrE function into P. luminescens metabolic networks during host infection?

Systems biology approaches provide powerful frameworks for integrating nqrE function into the broader metabolic context during P. luminescens host infection. Multi-omics integration should combine transcriptomics, proteomics, and metabolomics data from P. luminescens during different stages of insect infection, with particular attention to coordinated expression patterns between nqrE and other metabolic genes . Genome-scale metabolic modeling can predict how NQR activity influences metabolic flux distributions under different host conditions, particularly focusing on energy generation pathways and their connection to virulence factor production. Key model predictions should be validated through targeted metabolic flux analysis using ¹³C-labeled substrates. Network analysis can identify condition-specific modules where nqrE plays central roles, potentially revealing unexpected connections between sodium bioenergetics and other cellular processes. Interactome mapping through approaches like BioID or proximity labeling can identify physical and functional interactions between NQR components and other cellular machinery during infection. For in vivo relevance, dual RNA-seq comparing bacterial and host transcriptomes during infection can position nqrE function within both the pathogen's adaptive response and host countermeasures. Integration of these datasets through machine learning approaches can predict how perturbation of nqrE would propagate through the system, generating testable hypotheses about its role in coordinating metabolic adaptation during the transition between symbiotic and pathogenic lifestyles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.