Recombinant Photorhabdus luminescens subsp. laumondii Probable intracellular septation protein A (plu2483)

Shipped with Ice Packs
In Stock

Description

Research Applications and Expression Optimization

Plu2483 is primarily utilized as a reagent in ELISA kits for antibody development . Its recombinant production aligns with broader findings on heterologous protein expression in E. coli:

  • Translation Initiation Site Accessibility: A study analyzing 11,430 recombinant proteins found that mRNA secondary structure at translation initiation sites critically influences expression success. Subsequences near the Shine-Dalgarno sequence (−24:24 region) showed the strongest correlation with expression outcomes (AUC = 0.70) .

  • Synonymous Codon Optimization: Tools like TIsigner optimize the first nine codons of mRNA to enhance accessibility, increasing expression yields. For example, a Renilla luciferase variant with optimized codons showed 1.5× higher activity than wild-type .

These principles likely underpin Plu2483’s successful production, given its high purity and solubility .

Functional and Contextual Insights

While Plu2483’s exact biological role in P. luminescens is unclear, its designation as a septation protein implies involvement in bacterial cell division. Notably:

  • P. luminescens employs toxins like Mcf (Makes Caterpillars Floppy) and PirAB to kill insect hosts .

  • Plu2483 is distinct from these virulence factors but may contribute to bacterial survival during host infection by regulating cell division under stress .

Challenges in Recombinant Production

Key considerations for handling Plu2483 include:

  • Stability: Repeated freeze-thaw cycles degrade the protein; aliquots stored at −80°C are recommended .

  • Aggregation Risks: As observed in luciferase studies, high expression levels may lead to insoluble aggregates, necessitating solubility-enhancing tags or buffers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
yciB; plu2483; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
plu2483
Target Protein Sequence
MKQLLDFLPLVVFFVVYKMYDIFYASGALIAATGLAVAMTYFIYRKVEKASLITFIMVAV FGTLTLAFHSDLFIKWKVTVIYALFALALLGSQWFMKKPLIQKMLGKELILPDLVWNKLN MAWALFFTACALANIYVAFWLPQDVWVNFKVFGLTALTLVFTVLSVVYIYRHLPREQK
Uniprot No.

Target Background

Function

Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.

Database Links

KEGG: plu:plu2483

STRING: 243265.plu2483

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant plu2483?

For membrane proteins like plu2483, E. coli-based expression systems have been documented to produce functional recombinant protein with appropriate tags (such as His-tag) for purification purposes . When expressing plu2483, consider the following methodological considerations:

  • Use bacterial expression vectors with inducible promoters (such as T7 or tac) to control expression levels

  • Express in E. coli strains optimized for membrane proteins (C41/C43 or Lemo21)

  • Culture at lower temperatures (16-25°C) after induction to improve protein folding

  • Consider using fusion partners (such as MBP or SUMO) to enhance solubility

  • Use detergents during cell lysis and purification steps to solubilize the membrane protein

For experimental validation, always confirm expression using Western blotting with antibodies against the fusion tag or the protein itself, and assess protein localization within cellular fractions (cytoplasmic vs. membrane) .

How can researchers design experiments to study plu2483 interaction with other septation proteins?

To effectively study plu2483 interactions with other septation proteins, researchers should employ multiple complementary approaches:

  • In vitro protein-protein interaction assays:

    • Pull-down assays using His-tagged plu2483 as bait

    • Surface plasmon resonance (SPR) to measure binding kinetics (similar to approaches used for other proteins )

    • Crosslinking coupled with mass spectrometry to identify interacting partners

  • Cellular co-localization studies:

    • Fluorescently-tagged plu2483 expressed in bacterial cells

    • Co-immunoprecipitation from bacterial lysates

    • Bacterial two-hybrid systems

  • Functional complementation assays:

    • Express plu2483 in bacteria with mutated/deleted septation proteins

    • Assess rescue of septation defects through microscopy and growth analysis

When designing these experiments, researchers should include appropriate controls including wild-type bacteria, empty vector controls, and validated positive controls with known septation protein interactions . Use quantitative methods to measure interactions and apply statistical analyses to determine significance of observed interactions.

What methodologies can address contradictory findings about plu2483 function?

When addressing contradictory findings about protein function, researchers should implement a systematic approach similar to those used for resolving contradictions in biomedical literature :

  • Context analysis framework:

    • Categorize contradictions based on experimental conditions (internal vs. external factors)

    • Identify differences in species, strains, or growth conditions

    • Consider temporal aspects of experiments

    • Evaluate methodological differences between studies

  • Experimental design to resolve contradictions:

    • Conduct side-by-side comparisons under standardized conditions

    • Systematically vary individual parameters to identify sources of variation

    • Use multiple complementary techniques to assess function

  • Data integration approach:

    • Implement meta-analysis techniques where appropriate

    • Use normalized metrics for cross-study comparisons

    • Develop computational models to explain apparent contradictions

As seen in studies of recombinant proteins and contradictory literature claims, apparent contradictions often result from underspecified contexts, including differences in experimental parameters that weren't explicitly controlled or reported . When studying plu2483, careful documentation of all experimental conditions is essential for reproducibility and resolution of conflicting results.

What methods can researchers use to study the role of plu2483 in bacterial septation?

To characterize the role of plu2483 in bacterial septation, researchers should consider a multi-faceted approach combining genetic, biochemical, and microscopy techniques:

  • Genetic approaches:

    • Generate knockout/knockdown strains using CRISPR-Cas9 or transposon mutagenesis

    • Create point mutations in conserved domains

    • Develop complementation strains expressing wild-type or mutant versions

    • Use inducible expression systems to control protein levels

  • Microscopy-based analyses:

    • Phase-contrast microscopy to observe septation defects

    • Fluorescence microscopy with membrane stains (FM4-64) to visualize septation sites

    • Time-lapse microscopy to track septation dynamics

    • Super-resolution microscopy to precisely localize plu2483

  • Biochemical characterization:

    • Membrane fractionation to confirm localization

    • In vitro reconstitution of septation components

    • Activity assays (if enzymatic activity is predicted)

This multi-method approach provides complementary data to build a comprehensive understanding of plu2483 function in septation. Experimental designs should follow pre-experimental, quasi-experimental, or true experimental approaches depending on the specific question being addressed .

How can researchers validate the activity and proper folding of recombinant plu2483?

Validating proper folding and activity of recombinant membrane proteins like plu2483 requires specialized approaches:

  • Structural validation methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate conformational stability

    • Size-exclusion chromatography to confirm homogeneity

    • Thermal shift assays to measure stability

  • Functional validation approaches:

    • Liposome reconstitution assays

    • Complementation of bacterial strains lacking native plu2483

    • Binding assays with known interacting partners

    • Activity assays based on predicted biochemical function

  • Quantitative assessment:

    • Determine binding constants if interaction partners are known

    • Measure kinetic parameters if enzymatic activity is present

    • Compare activity metrics to native protein (if available)

For membrane proteins like plu2483, proper detergent selection during purification is critical for maintaining native-like folding. Validation should include comparisons of protein behavior in different detergent systems and potentially in nanodiscs or other membrane mimetics .

What are the methodological challenges in crystallizing plu2483 for structural studies?

Crystallizing membrane proteins like plu2483 presents significant challenges that require specialized approaches:

Researchers should implement parallel approaches and extensive screening conditions when attempting to determine the structure of plu2483. Success rates for membrane protein crystallization remain relatively low compared to soluble proteins, so multiple strategies should be pursued simultaneously.

How can researchers design experiments to study plu2483 mutations and their effects?

To study the effects of mutations on plu2483 function and activity, researchers should implement a comprehensive experimental design:

  • Mutation design strategy:

    • Target conserved residues identified through sequence alignment

    • Focus on predicted functional domains

    • Create alanine scanning libraries across transmembrane regions

    • Generate mutations mimicking natural variants (if known)

  • Expression and functional comparison:

    • Express wild-type and mutant proteins under identical conditions

    • Compare expression levels, stability, and membrane localization

    • Assess protein-protein interactions for each variant

    • Measure functional complementation in knockout strains

  • Quantitative analysis framework:

    • Develop clear metrics for functional activity

    • Use statistical methods to compare wild-type and mutant proteins

    • Consider kinetic parameters if enzymatic activity is present

  • Structure-function correlation:

    • Map mutations onto structural models (even if predicted)

    • Correlate functional defects with structural features

    • Use molecular dynamics simulations to predict effects of mutations

This approach mirrors successful mutational analysis strategies used for other proteins like PI3Kα inhibitors, where researchers demonstrated differences between wild-type and mutant proteins through binding affinity and kinetic measurements .

What statistical approaches are most appropriate for analyzing plu2483 activity data?

When analyzing experimental data related to plu2483 activity or function, researchers should employ appropriate statistical approaches:

  • For comparison between experimental groups:

    • Student's t-test for comparing two conditions

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normally distributed data

  • For kinetic or binding data:

    • Non-linear regression for fitting to appropriate models

    • Global fitting approaches for complex datasets

    • Bootstrap methods for robust parameter estimation

  • For high-dimensional data:

    • Principal component analysis for dimension reduction

    • Hierarchical clustering for identifying patterns

    • Machine learning approaches for complex pattern recognition

When reporting results, researchers should clearly state the statistical tests used, include measures of variability (standard deviation or standard error), provide exact p-values, and indicate sample sizes for all experiments . This approach ensures transparency and reproducibility in data analysis and interpretation.

How should researchers address potential contradictions in plu2483 literature?

To systematically address contradictions in the literature regarding plu2483 function or properties, researchers should:

  • Implement a structured analysis framework:

    • Categorize contradictions based on experimental context

    • Evaluate methodological differences between studies

    • Identify potential sources of variability in experimental conditions

    • Consider biological factors (strain differences, growth conditions)

  • Design targeted experiments to resolve contradictions:

    • Reproduce key experiments from conflicting studies

    • Systematically vary experimental parameters

    • Include appropriate controls for each variable

  • Use meta-analysis approaches:

    • Standardize metrics across studies

    • Weight studies based on methodological quality

    • Identify patterns across multiple studies

As demonstrated in other areas of biomedical research, apparent contradictions often result from underspecified contexts, including differences in species, temporal context, environmental conditions, or methodological approaches . By implementing a systematic approach to analyzing contradictions, researchers can advance understanding of plu2483 function despite initially conflicting results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.