Recombinant Photorhabdus luminescens subsp. laumondii Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ubiquinone Biosynthesis

UbiB is essential for the first monooxygenase step in CoQ biosynthesis, catalyzing the hydroxylation of the aromatic ring precursor. Key functional insights include:

  • Genetic Context: Operon-linked with ubiE (C-methyltransferase) and yigP in P. luminescens, indicating coordinated regulation .

  • Phenotypic Impact: ubiB knockout strains accumulate octaprenylphenol, a CoQ intermediate, and fail to synthesize functional CoQ .

  • Kinase Activity: Homology to Saccharomyces cerevisiae ABC1 kinase suggests UbiB may phosphorylate enzymes in the CoQ pathway to activate hydroxylation .

Mechanistic Studies

  • Polar Mutagenesis: Disruption of ubiE (upstream gene) via IS1 insertion causes transcriptional silencing of ubiB, leading to CoQ deficiency .

  • Complementation: Restoration of CoQ biosynthesis requires co-expression of ubiE, yigP, and ubiB, highlighting operon interdependence .

Comparative Analysis with Homologs

SpeciesProteinFunctionSequence Identity
Klebsiella pneumoniae UbiB (A6TGL5)CoQ biosynthesis, kinase activity~85%
Escherichia coli UbiB (YigR)Monooxygenase activation~78%
Providencia stuartii AarFCoQ biosynthesis~70%

These homologs underscore UbiB’s evolutionary conservation and role in aerobic respiration across Gram-negative bacteria .

Applications in Biotechnology and Medicine

  • Metabolic Engineering: Used to study CoQ-deficient phenotypes in model organisms .

  • Antimicrobial Targets: CoQ biosynthesis is absent in humans, making UbiB a candidate for narrow-spectrum antibiotics .

  • Protein Interaction Studies: Structural analysis informs kinase-substrate relationships in bacterial redox systems .

Related Research Context

While P. luminescens is renowned for insecticidal toxins (e.g., PirAB, Tc complexes) , UbiB represents a non-toxic metabolic enzyme critical for bacterial survival. Its study provides contrast to virulence-focused research on Photorhabdus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; plu4411; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYLIIRVFLSYGLDELIPRIRLTWPLRFGRYLLFWIPNRHKDKSLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPAIADQLALLQDRVASFDGALARQYIETALGGALETW FDDFEPIALASASIAQVHTARLKENGQEIVIKVIRPDILPIIKADIRLMYRLANWVPMLL PDGRRLRPREVVREYEKTLIDELNLLREAANAIQLRRNFENSSTLYVPEIYSDYCRENVL VMERVYGIPVSDIEALEAQNTNMRLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP EDPFYIGIDYGIVGSLNKDDKRYLAENFIAFFNRDYRKVAELHVDSGWVPSDTNVEDFEF AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMAVQPQLVLLQKTLLYVEGLGRQLYP QLDLWKTAKPFLEEWLHSQVGLPAVIRALKEKVPYWAEKLPELPELVYDSLQQHKHLQVS IEKLSGHLRGQQIKQRQSQYLLGVGATLFLCGSLFLLSGLANIPWLFIGAGTVSWLFGWC RLCKI
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links

KEGG: plu:plu4411

STRING: 243265.plu4411

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structural composition of Photorhabdus luminescens ubiquinone biosynthesis protein UbiB?

Photorhabdus luminescens subsp. laumondii UbiB is a protein with 545 amino acids belonging to the UbiB family. The protein contains a protein kinase-like (PKL) domain that is characteristic of this family. While classified as "probable ubiquinone biosynthesis protein," it shares structural features with other UbiB family members that have been more extensively characterized. The protein has a UniProt accession number of Q7MZ83 and is encoded by the ubiB gene (plu4411 locus) in the P. luminescens genome . The full amino acid sequence reveals several conserved motifs typical of the UbiB protein family, which includes regions critical for potential ATP binding and interaction with membrane components .

How is the Photorhabdus luminescens UbiB protein related to other UbiB family members such as COQ8?

Photorhabdus luminescens UbiB belongs to the highly conserved UbiB family of proteins that are characterized by a protein kinase-like (PKL) domain. This family includes the better-studied COQ8 proteins in humans (COQ8A and COQ8B), which are essential for coenzyme Q (ubiquinone) biosynthesis. While bacterial UbiB and eukaryotic COQ8 evolved in different organisms, they share functional similarities in ubiquinone biosynthesis pathways .

The relationship is not merely structural but also functional - mutations in key conserved residues of the protein kinase-like domain (particularly in ATP-binding regions) significantly affect protein stability and function, as demonstrated in studies with the related Cqd1 protein where mutations K275A and D288A led to reduced protein stability . This suggests evolutionary conservation of critical functional domains across the UbiB family from bacteria to humans.

What are the optimal storage and handling conditions for recombinant UbiB from Photorhabdus luminescens?

For optimal preservation of recombinant Photorhabdus luminescens UbiB protein activity, the following conditions are recommended:

  • Storage buffer: Tris-based buffer with 50% glycerol, specifically optimized for UbiB protein stability

  • Storage temperature: -20°C for short-term storage; -80°C recommended for extended storage

  • Working aliquots: Can be maintained at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as it may compromise protein integrity

  • Suggested quantity for experiments: Typically available in 50 μg quantities, though other amounts can be obtained for specific research needs

These conditions have been established to maintain the structural integrity and functional properties of the recombinant protein for experimental applications.

What experimental approaches are effective for assessing UbiB protein function in ubiquinone biosynthesis?

Several complementary experimental approaches can effectively assess UbiB protein function in ubiquinone biosynthesis:

Biochemical Activity Assays:

  • ATPase activity measurements to assess the protein's ability to hydrolyze ATP

  • Coenzyme Q (CoQ) quantification assays using HPLC-MS in cellular systems with and without functional UbiB

  • Protein-protein interaction studies to identify binding partners in the ubiquinone biosynthesis pathway

Genetic Approaches:

  • Gene knockout/knockdown studies to examine the phenotypic effects on ubiquinone levels

  • Complementation assays with wild-type and mutant versions to determine functional domains

  • Site-directed mutagenesis of conserved residues (particularly in the protein kinase-like domain) to identify critical amino acids for function

Structural Biology:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Molecular dynamics simulations to predict functional interactions

These methods should be employed in combination, as demonstrated in studies of related UbiB family members such as COQ8, where crystallography, activity assays, and cellular CoQ measurements were integrated to develop selective inhibitors and characterize protein function .

How can researchers effectively express and purify recombinant Photorhabdus luminescens UbiB protein for structural studies?

For high-yield expression and purification of functional Photorhabdus luminescens UbiB:

Expression System Selection:

  • Bacterial expression: E. coli BL21(DE3) or similar strains are commonly used for expressing bacterial proteins

  • For membrane-associated proteins like UbiB, consider using specialized E. coli strains developed for membrane proteins (e.g., C41/C43)

Expression Optimization:

  • Induction conditions: Lower temperatures (16-18°C) often improve folding of UbiB family proteins

  • IPTG concentration: Typically 0.1-0.5 mM for controlled induction

  • Expression time: Extended expression periods (16-24 hours) at lower temperatures may improve yield of functional protein

Purification Strategy:

  • Cell lysis: Gentle detergent-based methods to solubilize membrane-associated proteins

  • Affinity chromatography: Histidine-tagged constructs purified via Ni-NTA or similar matrices

  • Size exclusion chromatography: Critical for obtaining monodisperse protein preparations suitable for structural studies

  • Buffer optimization: Tris-based buffers with glycerol have proven effective for UbiB stability

Researchers should verify protein quality through activity assays before proceeding to structural studies, as protein kinase-like domains can be sensitive to purification conditions that may affect their conformational state and functionality .

What are the methodological challenges in studying UbiB protein interactions with other components of the ubiquinone biosynthesis pathway?

Several methodological challenges complicate the study of UbiB protein interactions:

Membrane Association Challenges:

  • UbiB proteins are often membrane-associated, making traditional interaction studies difficult

  • Detergent selection can significantly affect protein-protein interactions and activity

  • Risk of disrupting native membrane contexts that may be essential for functional interactions

Transient Interaction Detection:

  • UbiB family proteins may form transient rather than stable complexes

  • Time-resolved approaches may be necessary to capture dynamic interactions

  • Cross-linking strategies may be required to stabilize transient complexes

Functional Redundancy Issues:

  • Potential functional overlap with other proteins in the pathway complicates interpretation

  • Compensatory mechanisms may mask effects in single-protein studies

Technical Approaches to Address These Challenges:

  • Proximity-based labeling techniques (BioID, APEX) to identify neighboring proteins in the native cellular environment

  • Membrane-based two-hybrid systems specifically designed for membrane protein interactions

  • Native mass spectrometry with appropriate detergent/nanodisk systems

  • In situ structural techniques such as cryo-electron tomography

Evidence from related UbiB family members suggests these proteins may function at membrane contact sites, as seen with Cqd1 forming contacts between mitochondrial inner and outer membranes , indicating the importance of preserving membrane contexts when studying these interactions.

How does the protein kinase-like domain in UbiB contribute to its function in ubiquinone biosynthesis?

The protein kinase-like (PKL) domain in UbiB plays a crucial role in its function, though its exact mechanism differs from conventional protein kinases:

Structural Features and Function:

  • The PKL domain in UbiB proteins contains conserved ATP-binding motifs similar to conventional kinases

  • Unlike typical kinases, UbiB proteins may use ATP binding/hydrolysis for conformational changes rather than phosphoryl transfer

  • Conserved residues within this domain (particularly K275, D288, and E330 in related proteins) are critical for ATP binding

Experimental Evidence:

  • Mutation studies in related UbiB family members demonstrate that altering key residues in the ATP-binding pocket (K275A, D288A) severely affects protein stability and function

  • These mutations often result in reduced steady-state levels of the protein, suggesting proper folding or stability depends on an intact PKL domain

  • Small-molecule inhibitors targeting the ATP-binding pocket of the PKL domain in human COQ8 effectively inhibit coenzyme Q biosynthesis, confirming the domain's functional importance

Proposed Mechanisms:

  • ATP binding/hydrolysis may drive conformational changes that facilitate ubiquinone precursor interactions

  • The domain may provide a scaffold for assembling other components of the ubiquinone biosynthesis machinery

  • Energy from ATP hydrolysis might be used to overcome energetic barriers in the biochemical transformation of ubiquinone precursors

Understanding this domain's function has led to the development of selective inhibitors for human COQ8, which could provide further insights into ubiquinone biosynthesis mechanisms and potential therapeutic applications .

What is known about the role of UbiB in membrane homeostasis beyond its function in ubiquinone biosynthesis?

Research on UbiB family proteins has revealed roles in membrane homeostasis that extend beyond their direct function in ubiquinone biosynthesis:

Membrane Contact Site Formation:

  • UbiB family members such as Cqd1 have been identified as components of novel membrane contact sites in mitochondria

  • Cqd1 forms contacts between mitochondrial inner membrane and outer membrane proteins (Por1 and Om14), suggesting a structural role in organelle architecture

Phospholipid Homeostasis:

  • Deletion of Cqd1 (a UbiB family member) affects phospholipid homeostasis in addition to coenzyme Q distribution

  • This suggests UbiB proteins may coordinate lipid metabolism with ubiquinone production

Membrane Morphology Regulation:

  • Precise levels of UbiB family proteins appear critical for proper mitochondrial morphology

  • Overexpression of these inner membrane proteins can lead to their mislocalization to the outer membrane and abnormal tethering to the endoplasmic reticulum

Potential Compensation Mechanisms:

  • UbiB family members like Cqd2 can compensate for defects in other membrane contact site proteins (ERMES complex)

  • This functional redundancy highlights their importance in maintaining proper membrane architecture and function

These findings suggest that UbiB proteins serve as multifunctional components that integrate ubiquinone biosynthesis with broader aspects of membrane organization and lipid metabolism, making them key regulators of cellular energetics and membrane biology.

How do mutations in conserved residues of the UbiB protein affect its stability and function?

Mutations in conserved residues of UbiB proteins have profound effects on their stability and function, providing insights into structure-function relationships:

Key Conserved Residues and Their Effects:

MutationDomain LocationObserved EffectsFunctional Implication
K275AATP-binding pocketSeverely reduced protein levels, indicating decreased stability or expressionCritical for proper protein folding and/or stability
D288AATP-binding pocketStrongly reduced steady-state levels of proteinEssential for structural integrity of the protein
E330APKL domainLess severe effects on protein levels compared to K275A/D288AMay be involved in function but less critical for structural stability

Mechanistic Insights:

  • ATP-binding residues appear to be crucial not only for catalytic function but also for maintaining proper protein conformation

  • The severity of effects suggests these residues may be involved in core structural elements rather than just functional sites

  • Similar patterns observed across UbiB family members (Cqd1, Cqd2, Coq8) indicate evolutionary conservation of these structural requirements

Experimental Considerations:

  • When designing mutation studies, researchers should consider that severely destabilizing mutations may lead to phenotypes resulting from protein absence rather than specific functional defects

  • Complementation studies with carefully designed mutations can help distinguish between structural and purely functional roles of conserved residues

These findings highlight the dual role of the PKL domain in both structural stability and catalytic function of UbiB proteins, a feature that distinguishes them from conventional protein kinases .

How is the UbiB protein conserved across different bacterial species compared to its eukaryotic counterparts?

UbiB proteins represent a highly conserved family with interesting evolutionary patterns across prokaryotes and eukaryotes:

Conservation Patterns:

  • UbiB proteins are found across diverse bacteria including Photorhabdus luminescens, while eukaryotes primarily contain COQ8/ADCK homologs

  • The protein kinase-like (PKL) domain shows the highest conservation, particularly residues involved in ATP binding

  • Bacterial UbiB and eukaryotic COQ8 share core functional domains despite divergence in other regions

Comparative Analysis of Key Domains:

  • ATP-binding motifs in the PKL domain show remarkable conservation from bacteria to humans

  • Membrane-interacting regions show greater divergence, likely reflecting differences in membrane composition and organization

  • Regulatory elements often differ between bacterial and eukaryotic homologs, reflecting more complex regulation in eukaryotes

Functional Equivalence:

  • Despite sequence divergence, bacterial UbiB and eukaryotic COQ8 perform analogous functions in ubiquinone biosynthesis

  • Complementation studies have demonstrated that some bacterial UbiB proteins can partially rescue function in eukaryotic cells lacking COQ8, confirming functional conservation

  • Both protein families appear to use ATP binding/hydrolysis for non-canonical functions rather than conventional phosphoryl transfer

This evolutionary conservation highlights the fundamental importance of ubiquinone biosynthesis across all domains of life and suggests that insights gained from studying bacterial UbiB proteins may have relevance to understanding human COQ8-related diseases.

What genomic context surrounds the ubiB gene in Photorhabdus luminescens and how does this inform our understanding of its function?

The genomic context of the ubiB gene (designated as plu4411 in Photorhabdus luminescens subsp. laumondii) provides valuable insights into its functional associations:

Genomic Organization:

  • The P. luminescens genome contains 4,243 protein-coding genes with a G+C content of 42.4%

  • The genome has been fully sequenced, allowing comprehensive analysis of gene neighborhoods and potential operons

Gene Neighborhood Analysis:

  • The ubiB gene (plu4411) exists within a genomic context that includes other genes involved in electron transport chain function and energy metabolism

  • Proximity to other ubi genes suggests potential co-regulation of multiple steps in the ubiquinone biosynthesis pathway

Comparative Genomic Context:

  • Comparison with other bacterial species reveals conservation of gene organization around ubiB in related entomopathogenic bacteria

  • Differences in genomic context between bacterial UbiB and eukaryotic COQ8 reflect the distinct organization of ubiquinone biosynthesis pathways across domains of life

Functional Implications:

  • Co-occurrence patterns with other genes can predict functional associations

  • Operonic arrangements suggest coordinated expression with other components of energy metabolism

  • Genomic context supports the primary role of UbiB in ubiquinone biosynthesis while suggesting potential additional functions in energy metabolism integration

This genomic context analysis complements biochemical and genetic studies by providing an evolutionary perspective on the functional associations of UbiB in bacterial metabolism.

How can inhibitors of UbiB family proteins be developed and utilized for mechanistic studies?

Development of selective UbiB inhibitors represents an important research direction with both mechanistic and therapeutic implications:

Inhibitor Development Strategies:

  • Structure-guided approaches based on the protein kinase-like domain have proven successful

  • Repurposing of kinase inhibitor scaffolds, such as 4-anilinoquinoline derivatives, has yielded promising compounds

  • Crystal structures combined with activity assays and cellular CoQ measurements provide an effective pipeline for inhibitor development

Key Considerations for Inhibitor Design:

  • Selectivity against conventional protein kinases is essential

  • Targeting unique features of the ATP-binding pocket in UbiB proteins

  • Cell permeability must be optimized for cellular and in vivo studies

  • Species selectivity may be important for targeting specific UbiB family members

Research Applications of UbiB Inhibitors:

  • Acute inhibition allows temporal control not possible with genetic approaches

  • Dose-dependent inhibition enables titration of UbiB activity to identify threshold effects

  • Chemical-genetic approaches combining inhibitors with mutant proteins can validate on-target effects

  • Inhibitors can serve as scaffolds for development of activity-based probes to study UbiB protein dynamics

Case Study - COQ8 Inhibitor Development:
The development of TTP-UNC-CA157, a highly specific inhibitor for human COQ8, demonstrates the feasibility of this approach. This compound selectively inhibits human COQ8A in cells and has enabled mechanistic insights into UbiB protein function that were not possible through genetic approaches alone .

These chemical tools promise to significantly advance our understanding of UbiB protein mechanisms and may provide potential therapeutic strategies for diseases linked to dysregulation of coenzyme Q biosynthesis.

What are the implications of UbiB research for understanding mitochondrial diseases related to coenzyme Q deficiency?

Research on UbiB family proteins has significant implications for understanding and potentially treating mitochondrial diseases:

Clinical Relevance of UbiB Family Proteins:

  • Mutations in human COQ8A and COQ8B (UbiB family members) directly cause autosomal recessive cerebellar ataxia and steroid-resistant nephrotic syndrome

  • Understanding bacterial UbiB provides evolutionary context for human COQ8 function

  • Comparative analysis across species helps identify conserved mechanistic principles

Pathophysiological Mechanisms:

  • UbiB dysfunction leads to coenzyme Q deficiency, disrupting electron transport chain function

  • Beyond bioenergetic defects, CoQ deficiency affects membrane properties and antioxidant defense

  • UbiB family proteins' role in membrane contact site formation suggests additional disease mechanisms involving membrane organization disruption

Therapeutic Implications:

  • Small-molecule inhibitors of UbiB/COQ8 could serve as valuable research tools to understand disease mechanisms

  • Conversely, approaches to enhance UbiB/COQ8 function might represent therapeutic strategies for CoQ deficiency

  • Understanding UbiB's role in membrane homeostasis suggests targeting membrane organization could complement CoQ supplementation therapies

Future Research Directions:

  • Developing tissue-specific models of UbiB/COQ8 dysfunction to understand organ-specific disease manifestations

  • Investigating potential compensatory mechanisms that may explain clinical heterogeneity

  • Exploring the interaction between UbiB proteins and other membrane contact site components in disease contexts

This research demonstrates how basic studies on bacterial proteins can provide insights into human disease mechanisms and potential therapeutic approaches for mitochondrial disorders .

What emerging technologies might advance our understanding of UbiB protein function in the next decade?

Several emerging technologies hold promise for deepening our understanding of UbiB protein function:

Cryo-Electron Microscopy Advances:

  • High-resolution structures of UbiB proteins in membrane environments

  • Visualization of UbiB-containing complexes in their native state

  • Capturing different conformational states during the catalytic cycle

Integrative Structural Biology:

  • Combining X-ray crystallography, cryo-EM, NMR, and computational modeling

  • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Single-molecule FRET to observe real-time conformational changes during ATP binding/hydrolysis

Advanced Genetic Tools:

  • CRISPR-based approaches for precise genome editing across model organisms

  • Optogenetic and chemogenetic control of UbiB activity with temporal precision

  • Cell-type specific manipulation of UbiB function in complex tissues

Membrane Biology Innovations:

  • Expanded proximity labeling methods for mapping protein neighborhoods in membranes

  • Advanced fluorescence microscopy to visualize membrane contact site dynamics

  • Artificial membrane systems to reconstitute UbiB function in defined environments

Metabolomics and Systems Biology:

  • Comprehensive profiling of metabolic changes associated with UbiB manipulation

  • Network analysis to position UbiB within broader cellular systems

  • Integration of proteomics, lipidomics, and metabolomics data to build predictive models

These technologies will likely address current knowledge gaps, particularly regarding the precise mechanism by which UbiB proteins contribute to ubiquinone biosynthesis and membrane organization, potentially leading to novel therapeutic strategies for related diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.